DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and AgaP_AGAP003765

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_001230752.2 Gene:AgaP_AGAP003765 / 4577157 VectorBaseID:AGAP003765 Length:412 Species:Anopheles gambiae


Alignment Length:372 Identity:101/372 - (27%)
Similarity:166/372 - (44%) Gaps:51/372 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PEWLNEQFVTDVLRSHEKEPDLRVTKLDFTPGSAKGDNYASVIIRARVEY------ITQKGFFS- 70
            |||:...::..:||..|.:.||.||.::.||....|:..||.:.|..|.|      .|..|..| 
Mosquito    14 PEWVTSGYLETILRKFEGDKDLHVTDMESTPVGKPGEYLASQLFRVTVHYRGTKRNETDGGEGSA 78

  Fly    71 KSLIIKT-----VLEMFAGSALFKTEIGMYRKVLPEFARILRENNDTSRLYAECIYYSLEPSQVM 130
            |.|:||.     |:.......|||||:.||.::||:..|:|.:|.....| .:|::.|..|..::
Mosquito    79 KKLVIKIQPDKGVMADTMDGTLFKTELKMYGEILPKMERLLADNERPVPL-PKCVHVSATPQPII 142

  Fly   131 IFEDLGEMDYAMVRDRVLTHGEICGAYSKLAKFHALSMKIINERPEFVKEFKDGICLVDIPYM-- 193
            :.|||.. |.....|.:.:..|:......:|:|||.|..:...:.:| :||:..:.....|.:  
Mosquito   143 VLEDLAP-DGWKGHDLIESFEEVKPITIAIARFHAASFYLSKNKTDF-EEFQTDLFKNKHPVLEW 205

  Fly   194 --SSGMGPFKDFLGRIPELDRYKTHFEKIEVHFIDRLRDIMKEYQTNPQPG--YYVLCHGDYHTR 254
              .:.:..|.:.|......:|:...||:....:.|||.||    .....||  |.||.|||:|.:
Mosquito   206 MFGNNLKAFIESLRTWSGCERFVEPFERAYADYCDRLHDI----YCCKTPGRLYNVLNHGDFHAK 266

  Fly   255 NIMVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRIGELETLLNYYFSVLRETL 319
            |::.:.|.| ||..:...||:|.|..:..|.||.|.:..:::.:.:....|.::::|.:.....|
Mosquito   267 NLLHQFNDE-GGIAESRFLDFQACCWSTPAIDLYYLLNNIVHYKVKAAHKEEIVSFYHAEFTAAL 330

  Fly   320 RKIGYQGKLPDPPAFWKEMYRLKDYEFLFLSTYLPMSVGLSLETATN 366
            :.|||.|                         |:|..:.|.:|...|
Mosquito   331 KAIGYLG-------------------------YIPTMIDLQIELLRN 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 81/294 (28%)
APH <202..320 CDD:279908 33/119 (28%)
AgaP_AGAP003765XP_001230752.2 PKc_like 48..335 CDD:304357 81/294 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D279272at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11012
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.890

Return to query results.
Submit another query.