DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and CHKov2

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster


Alignment Length:429 Identity:99/429 - (23%)
Similarity:169/429 - (39%) Gaps:64/429 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LADQLNVPEWLNEQFVTDVLRSHEKEPDLRVTK--LDFTPGSA--KGDNYASVIIRARVE-YITQ 65
            :.|| ..|:|:.::..:.:|     |...|..|  :.|.|.||  ||:||.::::|.::| .:..
  Fly     1 MTDQ-PTPQWVTKELFSSLL-----EQSNRNFKAIIKFVPTSAISKGENYLTIVLRIQIEMQLKD 59

  Fly    66 KGFFSKSLIIKTVL----EMFAGSALFKTEIGMYRKVLPEFARILRENNDTSRLYAEC-IYYSLE 125
            ......|.|:|..|    |......:|..|:.||..::||...:..:|...|..:... :.:..|
  Fly    60 NSIEDVSYILKIPLVPEDEKNDFHEMFDAELDMYDHLIPELEDLYAKNTSISPKFKPVHLKFPGE 124

  Fly   126 P--SQVMIFEDLGEMDYAMV-RDRVLTHGEICGAYSKLAKFHALSMKIINERPEFVK-------- 179
            |  |..::.|||.:..|... |.:.|...|:.....|||::||.|.|.:.|..|:.|        
  Fly   125 PVKSDYILLEDLRKKGYRNADRTQGLEQFEVEAVLKKLAQWHAASAKRVVELGEYEKDIRESYFT 189

  Fly   180 --------EFKDGICLVDIPYMSSGMGPFKDFLGRIPELDRYKTHFEKIEVHFIDRLRDIMKEYQ 236
                    ||....|:   |::.. |..:....|::..:..|.:           :|.|:..|:.
  Fly   190 TEHQKLLDEFNINFCM---PFLEC-MQQYNLEPGQLVLISDYTS-----------QLTDLNIEFG 239

  Fly   237 TNPQPGYYVLCHGDYHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRI 301
            .|......||.|||:...|.|.|: |.:...||...:|:|.......|.||:..:........::
  Fly   240 KNDPLELSVLNHGDFWCNNFMFKY-KNASEVEDVCFVDFQLPKYGTPAQDLLCILMTSPKFSIKL 303

  Fly   302 GELETLLNYYFSVLRETLRKIGYQGKLPDPPAFWKEMYRLKDYEFLFLSTYLPM----------- 355
            .:.:..:.||...|.|.|..:.|....|....|...::|...:.|:.....||:           
  Fly   304 DKFDYFIEYYHQQLVEHLTMLNYNRNAPTLSKFHAHLHRYSLWAFICAQRMLPIVLLPPDVDSHI 368

  Fly   356 --SVGLSLETATNEETDDKLQDFIEECKSILARFERSGY 392
              .:|.|.|....:.....|..::::.|.||......||
  Fly   369 GNVMGNSEEAIAFKRKMFLLPAYVDQIKVILPWLINRGY 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 71/301 (24%)
APH <202..320 CDD:279908 26/117 (22%)
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 71/301 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459830
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.