DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and CHKov1

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001097918.1 Gene:CHKov1 / 43067 FlyBaseID:FBgn0045761 Length:410 Species:Drosophila melanogaster


Alignment Length:368 Identity:96/368 - (26%)
Similarity:166/368 - (45%) Gaps:59/368 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VPEWLNEQFVTDVLRSH-EKEPDLRVTKLDFTPGSAKGDNYASVIIRARVEYITQKGFFSKSLII 75
            :|:|:..:...|||:|: :....:|..|.:.  |||.|||||:.::|..:|...|.| .:|.|..
  Fly     6 IPDWVTAERFEDVLKSNVDGYSKVRNFKAEM--GSAAGDNYATNMLRVNIEVELQDG-TTKELSY 67

  Fly    76 KTVL--------EMFAGSALFKTEIGMYRKVLPEFARILR----ENNDTSRLY----AECIYYSL 124
            ...|        ||...:.:|:.|..||..|:||...:.:    |....::.|    |:..|.||
  Fly    68 MVKLPRQREINKEMMKHNNIFEIERTMYNLVVPEMEALYKAAGVEVTFGAKSYELKNAQTEYISL 132

  Fly   125 EPSQVMIFED---LGEMDYAMVRDRVLTHGEICGAYSKLAKFHALSMKII---NERPEFVKE--F 181
            |...:..|::   |..:|.|.. :|||         .|||::||.:...:   .:.||.|..  |
  Fly   133 EDLCIKGFKNANRLEGLDQAHT-ERVL---------RKLAQWHAATAVRVATKGQYPEIVLNGFF 187

  Fly   182 KDGICLVDIPYMS---SGMGPFKDFLGRIPELDRYKTHFEKIEVHFIDRLRDIM-----KEYQTN 238
            |:    .:.|.|:   :|||  :.|:......:..:.:.||::.     |:|:|     |....:
  Fly   188 KE----ENRPMMNDMMNGMG--QVFVKCCSTYEGNEAYIEKVKA-----LKDVMIDELFKMCVVD 241

  Fly   239 PQPGYYVLCHGDYHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRIGE 303
            |.. :.||.|||..:.|||.::: |||..::..::|:|......:|.||.|.:......|.::.:
  Fly   242 PTE-FNVLNHGDSWSNNIMFQYD-ESGKIKEVYMVDFQVSKYGTVAQDLYYFLISSTKLEDKLSK 304

  Fly   304 LETLLNYYFSVLRETLRKIGYQGKLPDPPAFWKEMYRLKDYEF 346
            .:..:..|...|.|.|:.:.|...||......|.:|:...:.:
  Fly   305 FDYYVKVYHDNLVEHLKILKYSKPLPSLRDIHKSLYKYGTFAY 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 80/308 (26%)
APH <202..320 CDD:279908 29/122 (24%)
CHKov1NP_001097918.1 EcKinase 41..325 CDD:397213 80/307 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459788
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.