DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and CG10562

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_651385.3 Gene:CG10562 / 43066 FlyBaseID:FBgn0039326 Length:405 Species:Drosophila melanogaster


Alignment Length:405 Identity:95/405 - (23%)
Similarity:174/405 - (42%) Gaps:78/405 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VPEWLNEQFVTDVLRSH-EKEPDLRVTKLDFTPGSAKGDNYASVIIRARVEYITQKGFFSKSLI- 74
            :|:|:..:...|:|::: :....::..|.|.  |||.|:|||::::|.::|...|.| .|||:. 
  Fly     6 IPDWVTAEIFEDLLKANVDGYSKIKNFKADI--GSAAGENYATIMLRVKIEVELQDG-KSKSVSY 67

  Fly    75 -------IKTVLEMFAGSALFKTEIGMYRKVLPEFARILR----------ENNDTSRLYAECIYY 122
                   ::.:.||...:.:|:.|..||.:|:||...:.:          :|.|...  |:..|.
  Fly    68 MVKLPHQVEAIQEMMKRTNIFEIERTMYNEVVPELEALYKAVGVDITFGAKNYDLKN--AKTDYV 130

  Fly   123 SLEPSQVMIFEDLGEMDYAMVR----------DRVLTHGEICGAYSKLAKFHALSMKIINERPEF 177
            :|        ||||...:....          :|||         .||:::||.|...:..:..:
  Fly   131 AL--------EDLGLKGFKNANRLEGLDQEHTERVL---------RKLSQWHAASAVRVATKGPY 178

  Fly   178 VKEFKDGICLVDI-PYMS---SGMGPFKDFLGRIPELDRYKTHFEKIEV---HFIDRLRDIMKEY 235
            .|....|....:. |.||   .|||  .:|:......:.::.:.:|::.   ..||::.:..|..
  Fly   179 PKILLQGFFKEESRPVMSEMIKGMG--ANFVKSCATYEGHEAYLDKVKALQPVAIDKIFEFAKVE 241

  Fly   236 QTNPQPGYYVLCHGDYHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQR 300
            .|.    :.||.|||..:.|||.::: ..|..::..|:|||......:|.||:|.:......|.:
  Fly   242 PTE----FNVLNHGDSWSNNIMFQYD-AFGKIKEVYLVDYQLPKYGTVAQDLLYFLLSSTKLEDK 301

  Fly   301 IGELETLLNYYFSVLRETLRKIGYQGKLPDPPAFWKEMYRLKDYEF-LFLSTYLPMSVGLSLETA 364
            :.:.:..:..|...|.|.|:.:.|...:|.          |:|... ||...|...:|...:.:|
  Fly   302 LAKFDYYIKIYHDNLVEHLKILKYSKPIPS----------LRDIHLALFKYGYFGYTVATGVMSA 356

  Fly   365 TNEETDD--KLQDFI 377
            ...:..|  .|::||
  Fly   357 VLLDPTDSASLENFI 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 73/311 (23%)
APH <202..320 CDD:279908 27/120 (23%)
CG10562NP_651385.3 EcKinase 41..325 CDD:281023 73/310 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459795
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.