DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and CG10553

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_651383.1 Gene:CG10553 / 43064 FlyBaseID:FBgn0039324 Length:414 Species:Drosophila melanogaster


Alignment Length:415 Identity:101/415 - (24%)
Similarity:180/415 - (43%) Gaps:56/415 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EDSLADQLNVPEWLNEQFVTDVLRSHEKEPDLRVTK-LDFTPGSAKGDNYASVIIRARV----EY 62
            ||....|:.:|:|:......::|:...|  |.:.|| :....|.|.|:|||:|::|..:    |.
  Fly     8 EDVSQKQVTIPDWVKPTVFEELLKRIVK--DYKATKSMRANAGVAAGENYATVMLRIELDVEKED 70

  Fly    63 ITQKGFFSKSLIIKT---------VLEMFAGSALFKTEIGMYRKVLPEFARILRENNDTSRLYAE 118
            .||.   :|:.::||         |:|.   :.:|..|.|||.:|:||..::.|:.....:..||
  Fly    71 NTQT---TKAFMLKTPHQSEQYRKVIEK---TDIFDVERGMYVEVVPELEQLYRDVGLEVKFGAE 129

  Fly   119 CIYYSLEPSQ-VMIFEDL-----GEMDYAMVRDRVLTHGEICGAYSKLAKFHALSMKIINERPEF 177
              .|.:|.|. .::.|||     |.:|.....|:..|.   | ...|.|::||.|...:..:..:
  Fly   130 --LYDIEASDYYVLLEDLRPRGFGNIDRLEGMDQAHTE---C-VLKKFAQWHAASAVRVETKGPY 188

  Fly   178 VKEFKDGIC----LVDIPYMSSGMGPFKDFLGRIPELDRYKTHFEKIEVHFIDRLRDIMKEYQTN 238
            .:::..|..    :||.....|    .|.||..:.....|:|:...:.: ...:..:|: |...|
  Fly   189 QEKYTKGFLRNEEIVDAFINRS----IKVFLDNVHLCKGYETYLNDLRI-VSGKTFEIV-ESLNN 247

  Fly   239 PQPGYYV-LCHGDYHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRIG 302
            |.|..:: |.|||....|||.::|.: |..:|...:|.|......:..||.|.:....:.:.:..
  Fly   248 PSPDEFIALNHGDGWANNIMSQYNTK-GEIQDTYFVDLQVPKWGSVTQDLYYFLLSSTSLDIKTS 311

  Fly   303 ELETLLNYYFSVLRETLRKIGYQGKLPDPPAFWKEMYRLKDYEFLFLSTYLPMSVGLSLETATNE 367
            :.:..:.:|.|.|.:.|:.:||...||........:.:...:.|:..:|.|..   :.|:.....
  Fly   312 KFDYFIWFYHSELVKHLKLLGYSKTLPTLRRINDALNKYSGWSFICTATILAY---VLLDPVDGA 373

  Fly   368 ETDDKLQDFIEECKSILARFERSGY 392
            :.|..|.|  ::|.     |:.|.|
  Fly   374 DFDKVLGD--DDCS-----FKNSLY 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 74/300 (25%)
APH <202..320 CDD:279908 27/118 (23%)
CG10553NP_651383.1 EcKinase 52..333 CDD:281023 74/299 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459774
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.