DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and CG31087

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001262952.1 Gene:CG31087 / 43062 FlyBaseID:FBgn0051087 Length:417 Species:Drosophila melanogaster


Alignment Length:415 Identity:102/415 - (24%)
Similarity:173/415 - (41%) Gaps:62/415 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NVPEWLN----EQFVTDVLRSHEKEPDLRVTKLDFTPGSAKGDNYASVIIRARVEY-ITQKGFFS 70
            |:|.||:    |:.|...:...||     :..:....||:.||||::..:|..||. :.......
  Fly    16 NLPSWLSKISLEKAVQAQIGDFEK-----IISVIPQKGSSDGDNYSTQFLRLLVEVELIDHSTKD 75

  Fly    71 KSLIIKT------VLEMFAGSALFKTEIGMYRKVLPEFARILRENNDTSRLYAEC---IYYSLEP 126
            .|.::|.      :..:.|...||:.|..||..:||:|          .:|||:.   |.::  |
  Fly    76 LSFVLKAQHSNEMMAAILAKLKLFQKEEQMYHSILPKF----------EKLYADAGKPIQFA--P 128

  Fly   127 SQVMIFEDLGEMDYAMVRD----RVLTHGEICG--------AYSKLAKFHALSMKIINERPEFVK 179
            .......||| :||.::.|    .......:.|        ...|||.|||.|...:.....|.:
  Fly   129 KAFKFDRDLG-VDYILLEDLHRKNFKNANRLAGLDLDHMHKVLEKLAAFHAASACYVEHHGLFGE 192

  Fly   180 EFKDGICLVDIPYMSSGMGPFKDFLGRIPELDRYKTHFEKI---EVHFIDRLRDIMKEYQTNPQP 241
            ||..|:.......:.........||.::.:....:..:||:   :.:.:|||   :::.|.|.:.
  Fly   193 EFTVGVFSESNRQLLQEFNASGAFLAQLKKWKNAQKIYEKLADSDDYLVDRL---LQDQQYNTRE 254

  Fly   242 GYYVLCHGDYHTRNIMVKHNKESGGFEDCMLLDYQ-GCYVAPLAFDLMYSIYMLMNREQRIGELE 305
             :.||.|||....|:|.:|: ..|..::.:.:|:| |.|.:| |.||.|.|......|.:..:.:
  Fly   255 -FNVLNHGDCWANNVMYQHD-AFGTIKETLFVDFQVGKYGSP-ANDLYYLILSSAAPELKTAKFD 316

  Fly   306 TLLNYYFSVLRETLRKIGYQGKLPDPPAFWKEMYRLKDYEFLFLSTYLPMSVGLSLETATNEETD 370
            .|:.|||..|.|.|:.:.|...||........::|.....::.:|..||:       ...::..|
  Fly   317 YLVRYYFDNLIENLKLLQYHRPLPKLKNLHASLFRNGLAAYMVVSKVLPV-------VMLDKTAD 374

  Fly   371 DKLQDFI-EECKSILARFERSGYFE 394
            ..|:.:| :|.|...|.|....|.:
  Fly   375 ANLESYISDESKMKNAMFTNPKYVQ 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 77/302 (25%)
APH <202..320 CDD:279908 35/121 (29%)
CG31087NP_001262952.1 EcKinase 52..335 CDD:281023 77/301 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459802
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.