DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and CG10514

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_651371.1 Gene:CG10514 / 43052 FlyBaseID:FBgn0039312 Length:413 Species:Drosophila melanogaster


Alignment Length:413 Identity:118/413 - (28%)
Similarity:188/413 - (45%) Gaps:65/413 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PEWLNEQFVTDVLRSHEKEPDLRVTKLDFTPGSAKGDNYASVIIRARVEY-ITQKGFFSKSLIIK 76
            ||||..:::...||.|.|:..|.:|:|...|....|:||..|:.|||||: ::.|....::||:|
  Fly     5 PEWLTHEYIEHALRCHYKDEGLTITQLQINPALGPGENYGGVLTRARVEFTLSNKEKNVQNLIVK 69

  Fly    77 TVL-------EMFAGSALFKTEIGMYRKVLPEFARILRENNDTSRLYAECIYYSLEPSQVMIFED 134
            |.:       |:.|...::..|:.:|::|||:...:|.|..||.|::...||...| ...:||||
  Fly    70 TEIDDDELTQELMAPYDIYNREMTIYQEVLPKCRELLNEIGDTERIFPTAIYVDRE-RMAIIFED 133

  Fly   135 LGEMDYAMVRDRVL------THGEICGAYSKLAKFHALSMKIINERPE---------FVKEFKDG 184
            |..:.|.|. |||.      ||..:    .||||||| :..::|||..         |...:.:.
  Fly   134 LSVVGYVMA-DRVRRLNEEHTHLIL----RKLAKFHA-ATAVLNERQSGCLESYDRGFFNRYTNA 192

  Fly   185 ICLVDIPYMSSGMGPFKDFLGRIPELDRYKTHFEKIEVHFIDRLRDIMKEYQTNPQPGYY-VLCH 248
            ..    .|...|:.....::.::|.|..|......:..|::|..|:...     |.||.. ||.|
  Fly   193 YS----GYFVGGLLAAARWMSKVPTLAHYGEKLFALAPHYMDIGRECFA-----PTPGQVNVLAH 248

  Fly   249 GDYHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMY----SIYMLMNREQRIGELETLLN 309
            ||..|.|:|.|::..:|...|.:|:|:|..:......||.:    |:...:.|:|:.|    |..
  Fly   249 GDVWTNNVMFKYDPNTGRPVDVLLIDFQYSFWGSPCIDLHHLFNTSLKEPLRRDQQNG----LFQ 309

  Fly   310 YYFSVLRETLRKIGY-QGKLPDPPAFWKEMYRLKDYEFLFLSTYLPMSVGLSLETATNEETDDKL 373
            :|..:..|||.|:.| |.::|....|..|:.:.:  .|...||.:...|.:|             
  Fly   310 FYHKIFTETLEKLNYRQNQIPSLHQFKLEVEQKR--FFALHSTVVVQPVMIS------------- 359

  Fly   374 QDFIEECKSILARFERSGY-FEN 395
            ||..:.|.:.|...:..|. |:|
  Fly   360 QDPTDACFNALMNDDERGIRFKN 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 89/304 (29%)
APH <202..320 CDD:279908 33/122 (27%)
CG10514NP_651371.1 EcKinase 39..324 CDD:281023 89/304 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459571
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.