DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and CG11878

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_651369.1 Gene:CG11878 / 43050 FlyBaseID:FBgn0039310 Length:420 Species:Drosophila melanogaster


Alignment Length:422 Identity:118/422 - (27%)
Similarity:187/422 - (44%) Gaps:48/422 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAEDSLADQLNVPEWLNEQFVTDVLRSHEKEPDLRVTKLDFTPGSAKGDNYASVIIRARVEYITQ 65
            |.|.|.......|.||..::|.|.||::.|:..|::..||..|..|.|.||.||:.|..|||.|:
  Fly     1 MTEKSTHKVHPAPVWLTSEYVQDKLRTYFKDSSLKLATLDTKPAVANGGNYGSVMTRINVEYTTK 65

  Fly    66 --KGFFSKSLIIKTVL-------EMFAGSALFKTEIGMYRKVLPEFARILR-ENNDTSRLYAECI 120
              ||..|.:.::||..       ::.....::..|:.:|..:||:.|.::| |..|:.:|:|..:
  Fly    66 VSKGKQSTTFLVKTTFADRDPAGDVLIHYGVYTREMDIYEHILPQLADMVRKELKDSRKLFAATM 130

  Fly   121 YYSLEPSQVMIFEDLGEMDYAMVRDR----VLTHGEICGAYSKLAKFHALSMKIINERPE-FVKE 180
            ....|...: ||||: .:|:..|..|    .|.|..:  ...|||.|||.|..:...:|. |.|.
  Fly   131 NVDRERDSI-IFEDM-SLDHYKVACRRKKLDLEHTHL--VLEKLALFHAASSVLAERQPGIFDKN 191

  Fly   181 FKDGI----CLVDIPYMSSGMGPFKDFLGRIPEL-DRYKTHFEKIEVHFIDRLRDIMKEYQTNPQ 240
            :..|.    .....|.|::.:......|....|| .|||...:::    ::||.| ..|..|...
  Fly   192 YDRGFFNKHTRAYAPIMTNLLEALSRSLASDEELGQRYKAKIDRL----VERLMD-YGERSTTSS 251

  Fly   241 PG-YYVLCHGDYHTRNIMVKHN-KESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRIGE 303
            || :..|.|||..|.|.|.::: ||..  .:.:.:|:|.......|.||.|.....:....|:..
  Fly   252 PGDFLTLAHGDLWTTNFMFQYDAKEHP--TNAIFIDFQFSVWNSPAIDLHYFFSTSLQDNLRLEH 314

  Fly   304 LETLLNYYFSVLRETLRKIGYQGKLPDPPAFWKEMYRLKDYEFLFLST-YLPMSVGLSLETATNE 367
            ...|:.:|:..|.|.|||:.|.|::|.          |.|::..|.|. :..:...|..|.....
  Fly   315 QTELVQFYYYRLTEALRKLKYAGRIPS----------LFDFQLQFRSRGFYAVFCSLIFEPVMQY 369

  Fly   368 E--TDDKLQDFIEECKSILARFERSGY-FENL 396
            |  .|..::..:...:|.: ||:.|.| .||:
  Fly   370 EGKEDASIEQVLSSSESGM-RFKNSVYESENI 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 84/298 (28%)
APH <202..320 CDD:279908 33/120 (28%)
CG11878NP_651369.1 EcKinase 47..335 CDD:281023 84/298 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459529
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.