DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and CG14314

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster


Alignment Length:421 Identity:93/421 - (22%)
Similarity:170/421 - (40%) Gaps:82/421 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ADQLNVPEWLNEQFVTDVLRSHEKEPDLRVTKLDFTPGSAKGDNYASVIIRARVEYITQKGFFSK 71
            |:.:...:.|:.:...|:.:  ..|||:::...:...||.:||||.:.:.|.::....:...:.:
  Fly    17 ANAVESKQILSLEVFQDIFK--HVEPDVQIDAFELAQGSDRGDNYTAALYRIKLTGKRRSLKWEQ 79

  Fly    72 SLIIKTV------LEMFAGSALFKTEIGMYRKVLPEFARI--LRENNDTSRLYAECIYYSLEPSQ 128
            ::|.|.:      .|.:....||:.|:..|..::||..:.  .:.|.||....|....||.. ..
  Fly    80 NVICKVMPESVVAREAYKSDKLFRNEVQFYNTIMPELLKFQASKTNQDTPVFNAIPKCYSAR-HD 143

  Fly   129 VMIFEDLGEMDYAMV-RDRVLTHGEICGAYSKLAKFHALSMKIINERP-EF---VKEFKDGI-CL 187
            ::|.|||.|..:.|. |.:.|:..|......::|:.|.||:....|:| ||   .....:|| |.
  Fly   144 LLIMEDLRERGFQMSDRHKGLSLEETQSVLLQVAQLHGLSLAYKFEKPLEFSNLCSMISEGIFCT 208

  Fly   188 VDIPYMSSGMGPFKDFLGRIPELDRYKTHFEKIEVHFIDRLRDIMKEYQTNPQPGYYVL------ 246
            .:..:                    |:.::|::..:.|..:.:::      |....|||      
  Fly   209 ANTSW--------------------YRNYYERLTKNAIQMVSEVL------PPDSKYVLAMNKFA 247

  Fly   247 ----------------------CHGDYHTRNIMVKHNKES-GGFEDCMLLDYQGCYVAPLAFDLM 288
                                  ||||....|.:..::.|. ....:..|||:|....:.:|.|:.
  Fly   248 ESSSFFGRMVKLASTESPLSAICHGDCWVNNFLYHYDPEDPHRVLEVALLDFQLIRYSSIALDIA 312

  Fly   289 YSIYMLMNREQRIGELETLLNYYFSVLRETLRKIGYQGKLPDPPAFWKEMYRLKDYEFLFLSTYL 353
            ..:|....:|.|..:|:|||..|...|...|:.:  ...|||   ....:.:|:|.....|.||.
  Fly   313 NLLYCCTTKEMRDAQLQTLLKIYTEELFRWLQML--CTNLPD---HCDTLQKLQDLFAEELKTYG 372

  Fly   354 PMSVGLSLE-----TATNEETDDKLQDFIEE 379
            ..::||:|:     |.::|:..|...|..:|
  Fly   373 RFALGLALDILPISTCSSEDAPDMYLDRSDE 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 69/319 (22%)
APH <202..320 CDD:279908 28/146 (19%)
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 69/316 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.