DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and CG6830

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster


Alignment Length:419 Identity:100/419 - (23%)
Similarity:183/419 - (43%) Gaps:59/419 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DQLNVPEWLNEQFVTDVLRSHEKEPDLR-----VTKLDFTPGSAKGDNYASVIIRARVE-YITQK 66
            ||  :|:|||.....:::.|  .||:..     .:||...|    |||:||.:::..:| .:...
  Fly   480 DQ--IPDWLNIDDFKEIILS--AEPNFEKILSSTSKLATKP----GDNFASKLLKVEIEAQLKDN 536

  Fly    67 GFFSKSLIIKTVLE----MFAGSALFKTEIGMYRKVLPEFARILRE--------------NNDTS 113
            ...:.|.|:|...:    .|:...||..||.:|...:|.|.|..::              :.|.|
  Fly   537 SVKTFSYILKVHSDNDAINFSDFNLFPKEIEVYSTYVPAFERFYKDVGLPVTFSPKSFRLSKDVS 601

  Fly   114 RLYAECIYYSLEPSQVMIFEDLGEMDYAMVRDRVLTHGEICGAYSKLAKFHALSMKIINERPEFV 178
            :.|  .:..:|:||...:.:.:..||        |.|.: | ...|||::||.|:|.......:.
  Fly   602 KEY--LLLENLQPSGFKMVDRMIGMD--------LEHSK-C-TLKKLAQWHAASLKYKELNGPYS 654

  Fly   179 KEFKDGICLVDIPYMSSGM--GPFKDFLGRIPELDRYKTHFEKI-EV--HFIDRLRDIMKEYQTN 238
            .::.:||.......:..||  ...|.|:..:.:.|....:..|: |:  .::||   |:::.:.|
  Fly   655 PKYNNGIFTEQTAPIFKGMFVNTKKSFIEEVSKFDGVDEYLHKMPEILDTYVDR---ILEDAKIN 716

  Fly   239 PQPGYYVLCHGDYHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRIGE 303
            .| .:.||.|||....|||.::..: |..::.:|||:|.......|.||.|.|......:.::.:
  Fly   717 EQ-AFNVLNHGDAWINNIMFQYESD-GRVKETLLLDHQVTKYGNPAQDLYYFIMSSTQLDIKVDQ 779

  Fly   304 LETLLNYYFSVLRETLRKIGYQGKLPDPPAFWKEMYRLKDYEFLFLSTYLPMSVGLSLETATNEE 368
            .:.|:.:|...::|..:.:.|.|.:|.    .||::.:.....:|.:..:..::.:.|...|::.
  Fly   780 FDYLIRWYHQNMKEHAKLLNYNGFIPS----LKELHAILIQHPIFAAGTVLTTLSMCLNKTTDDF 840

  Fly   369 TDDKLQDFIEECKSIL-ARFERSGYFENL 396
            |.|......|..||:. |.|....|..|:
  Fly   841 TTDSFLGNEENGKSLREAMFSNERYRANI 869

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 71/300 (24%)
APH <202..320 CDD:279908 30/120 (25%)
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 72/304 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459823
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.