DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and CG5644

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_648274.1 Gene:CG5644 / 39029 FlyBaseID:FBgn0035948 Length:459 Species:Drosophila melanogaster


Alignment Length:359 Identity:81/359 - (22%)
Similarity:126/359 - (35%) Gaps:107/359 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LRSHEKEPDLRVTKLDFTPGSAKGDNYASVIIRARV--------------EYITQKGFFSKSLII 75
            |.|..|.....:..:..:.||:.||||.||:.|..:              |.:|        :|:
  Fly    42 LFSQSKLVSFSIAHIACSAGSSSGDNYMSVVKRVTISQAGKDQDPELAGSEIVT--------VIV 98

  Fly    76 KTVL------EMFAGSALFKTEIGMYRKVLPEFARILRENNDTSRLYAECIYYSLEPSQ------ 128
            |..:      :::.....|..||..||.:.|..|...|.     :|:..|   .:..||      
  Fly    99 KRQIASLSRRQLYRCEEAFSNEINAYRHLAPLLAAHSRH-----QLFPVC---HIAESQDRRDAE 155

  Fly   129 ----VMIFEDLGEMDYAMVRDRV--LTHGEICGAYSKLAKFHALSMKIINERPEFVKEFKDGICL 187
                :::.:||..|.:.| :||:  |...:......|||:.||.|:.        .:|.:     
  Fly   156 GGEPIIVLQDLKAMGFRM-KDRLAGLELSDCLLVMKKLAQLHAASLA--------AQELE----- 206

  Fly   188 VDIPYMSSGMGPFKDFLGRIPELDR----YKTHFEKIEVHFIDRLRD------------IMKEYQ 236
                  ||......|.|..|...|.    |.|..:......::.|.|            :::|.:
  Fly   207 ------SSSFAFHADHLQEIVYCDEATDFYATILDTSVQQALESLGDANADDCLTTPIRLLEELR 265

  Fly   237 TN---------------PQPGYYVLCHGDYHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFD 286
            ||               |..   |:||||....|||.:...     |:.:..|.|....:...||
  Fly   266 TNLFENLKHEINATAAAPNS---VICHGDLWVNNIMFRSEP-----EEVIFFDLQAMRKSSPIFD 322

  Fly   287 LMYSIYMLMNREQRIGELETLLNYYFSVLRETLR 320
            :::.||....|..|....:|||..|...|.|.||
  Fly   323 ILHFIYTSTRRPLRDVHTDTLLAAYSQALSEELR 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 76/337 (23%)
APH <202..320 CDD:279908 35/148 (24%)
CG5644NP_648274.1 EcKinase 65..357 CDD:281023 76/336 (23%)
P-loop_NTPase <357..435 CDD:304359 81/359 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.