DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and CG11889

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001287526.1 Gene:CG11889 / 3772506 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster


Alignment Length:406 Identity:117/406 - (28%)
Similarity:187/406 - (46%) Gaps:43/406 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NVPEWLNEQFVTDVLRSHEKEPDLRVTKLDFTPGSAKGDNYASVIIRARVEYITQ--KGFFSKSL 73
            |.|.||.|::|...||.:.|...|.:.||...|.:|.|:|||||:.|..|||||:  |...|.:.
  Fly     8 NAPAWLTEEYVEKKLRVYFKNDTLNLKKLTIKPATANGENYASVMTRISVEYITKDSKDNQSATF 72

  Fly    74 IIKTVL-------EMFAGSALFKTEIGMYRKVLPEFARILR-ENNDTSRLYAECIYYSLEPSQVM 130
            ::||..       .:.....::..||.||.::||..|.|:: |.:|:.:|:|..:....|...:|
  Fly    73 LLKTTFADKDPAAHLLINYGIYTREIDMYEQILPRLADIVKNELHDSRKLFAATVGVDRERDSIM 137

  Fly   131 IFEDLGEMDYAM---VRDRVLTHGEICGAYSKLAKFHALSMKIINERPE-FVKEFKDGICLVDI- 190
             ||||....|.:   |:...|.|..:  ...|||.|||....:...:|. |.|.:..|.....: 
  Fly   138 -FEDLSLERYKVACRVKKLDLEHTYL--VLEKLADFHAAGAALAQRQPGIFEKNYDRGFFNKHVR 199

  Fly   191 ---PYMSSGMGPFKDFLGRIPEL-DRYKTHFEKIEVHFIDRLRDIMKEY---QTNPQPGYYV-LC 247
               |.|.:.:......|...|:| :||:..        ||||.|.:.:|   .|:..||.:| |.
  Fly   200 GYEPIMKNILKALSRTLDLSPDLKERYQAK--------IDRLIDNVMDYGERSTSVAPGDFVTLA 256

  Fly   248 HGDYHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRIGELETLLNYYF 312
            |||..|.|:|.:::.| |...:.:.:|:|.......|.||.|.....::...|:.....|:.:||
  Fly   257 HGDIWTTNVMFQYDDE-GHPVNAIFIDFQFSVWNSPAIDLQYFFSTSIHENLRLERQTELVQFYF 320

  Fly   313 SVLRETLRKIGYQGKLPDPPAFWKEMYRLKDYEFLFLS-TYLPMSVGLSLET------ATNEETD 370
            ..|...|.::.|.||:|....| ::.:|.|.:..:|.| .:.|..|....|.      .|::|..
  Fly   321 YKLVVALERVKYSGKVPSLFEF-QQQFRTKGFYAVFASLIFEPTMVYNGKEEPSIEQFMTSDEKG 384

  Fly   371 DKLQDFIEECKSILAR 386
            .:|:|.:.:.:..|.:
  Fly   385 VRLRDAVYQTEENLKK 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 86/299 (29%)
APH <202..320 CDD:279908 35/122 (29%)
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 86/299 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459536
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.