DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and CG11891

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001027211.3 Gene:CG11891 / 3772439 FlyBaseID:FBgn0039309 Length:417 Species:Drosophila melanogaster


Alignment Length:401 Identity:111/401 - (27%)
Similarity:175/401 - (43%) Gaps:62/401 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VPEWLNEQFVTDVLRSHEKEPDLRVTKLDFTPGSAKGDNYASVIIRARVEYITQKGFFSKSLIIK 76
            ||.||...:|...|||:.:...||:..||.......|:||:|||.|..|||.|.|....:|    
  Fly    12 VPAWLTRDYVEQKLRSYFRNDSLRLVNLDIKLALGNGENYSSVITRIYVEYTTDKSKDKQS---- 72

  Fly    77 TVLEMFAGS----------ALFKTEIGMYRKVLPEFARILR-ENNDTSRLYAECIYYSLEPSQVM 130
            |....||.:          .::..|:.:|.::||:.|.::| |..|:.:|:|..:|...:...: 
  Fly    73 TRFTRFADAGPAAQVLLSYGVYNRELDLYERILPQMAEVVRNELADSRKLFAGTVYVDRKRDSI- 136

  Fly   131 IFEDLGEMDYAMVRDRV----LTHGEICGAYSKLAKFHALSMKIINERPE-FVKEFKDGICLVDI 190
            ||||:...:| .|.||:    |.|..:  ...|||.|||....:...:|. |.|.|..|......
  Fly   137 IFEDMSLENY-RVADRLKKLDLEHTHL--VLEKLANFHAAGAALAERQPGIFAKNFDRGFFNQHT 198

  Fly   191 ----PYMSSGMGPFKDFLGRIPEL-DRYKTHFEKIEVHFIDRLRDIMKEY---QTNPQPG-YYVL 246
                |.|.:.:......|...|:| .||:..        ||||.:.:.||   .|...|| :..|
  Fly   199 RGYEPIMKNLLMALSRSLELEPDLCQRYQAK--------IDRLVENVMEYGERSTTIVPGDFLTL 255

  Fly   247 CHGDYHTRNIMVKHNKESGGFEDCMLLDYQ-GCYVAPLAFDLMYSIYMLMNREQRIGELETLLNY 310
            .|||..|.|||.::: :.|...:.:.:|:| ..:.:| |.||.|.....:..:.|:.:...|:.:
  Fly   256 AHGDLWTTNIMFQYD-DKGHPINAIFIDFQFSAWNSP-AIDLHYFFSTALQADIRLKKQPELVQF 318

  Fly   311 YFSVLRETLRKIGYQGKLPDPPAFWKEMYRLKDYEFLFLS-------TYLPMSVGLSLETATNEE 368
            |:..|...|:|:.|.|.:|....| .:.:|.:.:...|.|       ||          |...|.
  Fly   319 YYYKLNAALKKVQYSGNVPSLFVF-HQQFRNRSFYAAFASLIFEPTMTY----------TGKEEA 372

  Fly   369 TDDKLQDFIEE 379
            :.|::....|:
  Fly   373 SMDQIISLSEK 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 86/302 (28%)
APH <202..320 CDD:279908 34/123 (28%)
CG11891NP_001027211.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.