DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and CG16898

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_611452.2 Gene:CG16898 / 37276 FlyBaseID:FBgn0034480 Length:407 Species:Drosophila melanogaster


Alignment Length:417 Identity:94/417 - (22%)
Similarity:187/417 - (44%) Gaps:72/417 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VPEWLNEQFVTDVLRSHEKEPDLRVTKLDFTPGSAKGDNYASVIIRARVEYITQKGFF-SKSLII 75
            :|.||.|:::...||::.|:..|:|.|:...|.:.||.||.|::.|..||.....|.. :::.||
  Fly     2 LPNWLTEEYLQPKLRAYYKDDQLKVVKVWAKPATEKGQNYMSLMTRIHVEIQQGDGLLQNRTYII 66

  Fly    76 KTVL-------EMFAGSALFKTEIGMYRKVLPEFARILRENNDTSRLYAECIYYSLEPSQVMIFE 133
            |..|       ::|....::..|:.||..:||:...:|:|...|.:..|:.|:...| .:.:|.|
  Fly    67 KESLSEDCPQAKVFLEYDVYNREMDMYEFILPKMNELLQEVGLTGKFTADTIFVDRE-YRTIILE 130

  Fly   134 DLGEMDYAMVRDRV----LTHGEICGAYSKLAKFHALSMKIINERPEFV---------------- 178
            ||.:.:|... |||    |.|.::  ....||||||.|:.:....||.:                
  Fly   131 DLAQYNYVNA-DRVKQLDLAHTKL--TLEVLAKFHAASIVVKQRHPELLTKSLFIHCFSRDNKGY 192

  Fly   179 KEFKDGICLVDIPYMSSGMGPFKDFLGRIPEL-DRYKTHFEKIEVHFIDRLRDIMKEYQTNPQPG 242
            .|..:|:           :..|..|:...|.| .:|....:||..:.:|.   ..:.::...|. 
  Fly   193 TEVYEGV-----------LSAFIRFINEQPVLKKKYGNKLQKIHENIMDY---GARTFEVGEQE- 242

  Fly   243 YYVLCHGDYHTRNIMVKHNKESGGFEDCMLLDYQ-GCYVAPLAFDLMYSIYMLMNREQRIGELET 306
            ...|.|||..|.|.:.:::..|.. :..:.:|:| ..:.:|:  :.::..:.:..|:: :.::|:
  Fly   243 LLTLSHGDCWTTNFLYQYDDASNP-QSAVAIDFQFSNFTSPV--NDLHQFFTVSLRDE-VQDMES 303

  Fly   307 -LLNYYFSVLRETLRKIGYQGKLPDPPAFWKEMYRLKDYEFLFLSTYLPMSVGLSLETATN---- 366
             |:..|:|.|:..:..:.|:|..|....|.|: :..:.:..|....:.|:.:....|.:::    
  Fly   304 VLVEKYYSDLKTNVDTLSYKGIFPSLQGFQKQ-FESRRFMCLLAHLFKPVIIYDGTEVSSDFSSV 367

  Fly   367 -EETDDKLQDFIEECKSILARFERSGY 392
             ::|::.:            ||:::.|
  Fly   368 YKDTEEGI------------RFQKAIY 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 71/307 (23%)
APH <202..320 CDD:279908 24/120 (20%)
CG16898NP_611452.2 EcKinase 37..322 CDD:281023 71/307 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459550
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.