DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and JhI-26

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_523761.2 Gene:JhI-26 / 36819 FlyBaseID:FBgn0028424 Length:439 Species:Drosophila melanogaster


Alignment Length:385 Identity:95/385 - (24%)
Similarity:159/385 - (41%) Gaps:66/385 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 EWLNEQFVTDVLR--------SHEKEPDLRVTKLDFTPGSAKGDNYASVI---IRARV--EYITQ 65
            :||....:..:||        |..|.....|..:|.   ...|.:.|.::   .|..:  ||..|
  Fly     9 QWLRYTVLPSILRNGRLVDNYSESKVTTFHVGDIDI---DVIGHSEAFMLTFCYRTTINFEYDGQ 70

  Fly    66 KGFFSKSLIIK-------TVLEMFAGSALFKTEIGMYRKVLPEFARILRENNDTSRLYAECIYYS 123
            |  |.:.:::|       .:.|......||..||..|.::||||.:.      |...:|...||.
  Fly    71 K--FQRKMVVKKTPAMPPEMYESIQFGPLFTNEINFYTEILPEFQKF------TDGKFAAPKYYY 127

  Fly   124 LEPSQ---VMIFEDLGEMDYAMVRDRV---LTHGEICGAYSKLAKFHALSMKIINERPEFVKEFK 182
            .|.:|   |.|.|:..|..:.:.:|||   |.|..|  |.|.|.:||..:..:.::.||...:..
  Fly   128 GELNQHSAVAILENFAEQGWRVTKDRVGLSLQHAMI--AVSYLGRFHGFAYAMKHKNPEKFAQLT 190

  Fly   183 DGICLVDIPYMSSGMGP-FKDFLGRIPELDR----YKTHFEKIEVHFIDRLRDIMKEY------Q 236
            |.  |.:..|.:..:.| :|  |.....:||    ..|:..:|:..|:.:...::.:|      :
  Fly   191 DN--LKESRYANDNIHPEWK--LTMKTSIDRAAKAVATYQPQIDEEFVKKFCFMISDYSQYGRQR 251

  Fly   237 TNPQPGYYVLCHGDYHTRNIMVKH-NKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQR 300
            ..|:.....||||||...|:..:: :||..  ::.|:.|||...|:....||...:.:.:..|.|
  Fly   252 VAPREPLATLCHGDYVRNNVAYRYDDKEEP--QEIMMFDYQTLRVSSPMVDLNVFLAVSIFAEVR 314

  Fly   301 IGELETLLNYYFSVLRETLRKIGYQGKLPDPPAFWKEMYRLKDYEFLFLSTYLPMSVGLS 360
            ....|.:...|...|..:.|:...: ::||   |......||:|     ..:||.|:.:|
  Fly   315 DPNFEAIFCEYTLALHNSYREHAKE-EVPD---FLSRGELLKEY-----VRFLPYSLSIS 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 77/306 (25%)
APH <202..320 CDD:279908 29/128 (23%)
JhI-26NP_523761.2 EcKinase 54..330 CDD:281023 73/291 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.