DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and F59B1.10

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_872223.1 Gene:F59B1.10 / 353438 WormBaseID:WBGene00019101 Length:428 Species:Caenorhabditis elegans


Alignment Length:353 Identity:77/353 - (21%)
Similarity:136/353 - (38%) Gaps:55/353 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 VIIRARVEYITQKGFFSKSLIIKTVLEMFAGSALFKTEIGMYRKVLPEFARILRENNDTSRLYAE 118
            |.|:|.::...|:   :.|||.|.|.|..  .|.|::...........|..:..:.|..:.|..:
 Worm    84 VHIQALIDKGKQQ---NASLITKEVEEQM--YAYFESSCKKMHNQEMNFYEVAGKFNSKTLLIPK 143

  Fly   119 CIYYS-LEPSQVMIFEDLGEMDYAMVRDRVLTHG-------EICGAYSKLAKFHALSMKIINERP 175
            ..:|: |:...    .:.|.:....|...::.|.       ||......:||..|||::...|..
 Worm   144 VYFYTKLDEKN----SNKGFIGMEYVEGSIVRHSYDTCTIEEIQPILRAIAKLQALSLQNPAEIS 204

  Fly   176 EFVKEFKDGICLVDIPYMSSGMGPFKDFLGRIPELDRYKTHF-EKIEVHFIDRLR-------DIM 232
            :.:::..:|....:...|.......|....:...|:|  :.| ||     :||:.       |..
 Worm   205 KDLQKIDNGAIFQETLKMMLSESGIKGIFEQCRNLER--SRFGEK-----VDRIEEKRNEILDFE 262

  Fly   233 KEYQTNPQPG--YYVLCHGDYHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLM 295
            |.:..|...|  ..||||||....|.:...|  :|.|....::|||..::...|.||:..:...:
 Worm   263 KAFNLNKVVGIKQNVLCHGDLWAANFLWTEN--NGVFCATRIVDYQMSHLGNPAEDLVRLLVSTI 325

  Fly   296 NREQRIGELETLLNYYFSVLRETLRKIGYQGKLPDPPAFWKEMYRLKDYEFLFLSTYLPMSVGLS 360
            ....|....:.:|..::|..   |.::| .|:.|         |.|:..:..| ..|.|:. .|:
 Worm   326 TGADRQAHWQQILEQFYSYF---LNELG-SGEAP---------YTLEQLKLSF-KLYFPVG-ALA 375

  Fly   361 LETATNEETDDKLQ----DFIEECKSIL 384
            |........|.||:    :..|:|:.::
 Worm   376 LLPLFGPAVDAKLEGMDSEKAEKCRHVV 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 62/287 (22%)
APH <202..320 CDD:279908 30/127 (24%)
F59B1.10NP_872223.1 DUF1679 8..422 CDD:369592 77/353 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.