DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and CG33509

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster


Alignment Length:386 Identity:81/386 - (20%)
Similarity:157/386 - (40%) Gaps:60/386 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KEPDLRVTKLDF------TPGSAKGDNYASVI--IRARVEYITQKGFFSKSLIIKTVLEMFAGSA 86
            :|..:||..||:      :.....||.||..:  .....|.|.:...|.|::..::.  ..:..:
  Fly    15 QESAVRVKLLDYHLVRDLSAIGYLGDYYALTLRYCHEEEEIIREIELFVKAMPQQSA--ELSKES 77

  Fly    87 LFKTEIGMYRKVLPEFARILRENNDTSRLYAECIYYSLEPSQVMIFEDLGEMDYAMVRDRVLTHG 151
            :|:.|..:|..::.:...:     ...:....|:|   ....:|:.|::....:.......|...
  Fly    78 IFQKESWLYDTLIKKLQAL-----SNVKWSPNCVY---SRKDLMVLENIKLKGFTSAGSAELNEV 134

  Fly   152 EICGAYSKLAKFHALSMKIINE-RPEFVKEFKDGICLV----DIPYMSSGMGPFKDFLGRIPELD 211
            .:......:|.||:.|:...:: :......:.|.:..:    :|.:.::|:..   .|..:..|.
  Fly   135 FVKPLIKSIAAFHSASLVYEHQTKTNIGHTYGDNLLEITVDSEIAWFTTGLSA---VLAVVRSLA 196

  Fly   212 RYKTHFEKIEVHFI-DRLRDIMKEY--QTNPQPGY-YVLCHGDYHTRNIMVKHNKESGGFEDCML 272
            :|:.:.|:   .|| |:|..||:..  |..|...| .||||.|....||...  .|:.|  ..:|
  Fly   197 KYQGNREQ---SFIGDKLMGIMETIYEQAAPSKKYRNVLCHRDIWAGNIFFP--PENSG--PALL 254

  Fly   273 LDYQGCYVAPLAFDLMYSIYMLMNREQRIGELETLLNYYFSVLRETLRKIGYQGKLPDPPAFWKE 337
            :|:|.|..||.|.||.:.:||.::..:|....:..::.|.:.|.:.|..:|.: :|....:...|
  Fly   255 IDFQTCRYAPPASDLNFCLYMNLSSSKRKQMEKQGIDLYHTYLLQNLSDLGLE-ELVISKSELLE 318

  Fly   338 MYRLKDYEF-LFLSTYLPMS---VGLSLETATNE--------------ETDDKLQDFIEEC 380
            .|.    || ||...|..::   |.:..:..||:              :|:.:...::|||
  Fly   319 SYE----EFRLFGVVYRAVAATVVKVPTDFITNDFKYVDRSKVILSYMKTNPEFATYMEEC 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 60/287 (21%)
APH <202..320 CDD:279908 36/121 (30%)
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 53/261 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459876
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.