DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and CG33510

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001014493.2 Gene:CG33510 / 3346224 FlyBaseID:FBgn0053510 Length:426 Species:Drosophila melanogaster


Alignment Length:360 Identity:73/360 - (20%)
Similarity:144/360 - (40%) Gaps:86/360 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 QKGFFSKSLIIKTVLEMFAGSALFKTEIGMYRKVLPEFARILRENNDTSRLYAECIYYSLEPSQV 129
            ||...:..|.:|:|:...|....:..::|:..|.:..:..:......:..:::...|::.:  .:
  Fly    71 QKDVQTSRLFVKSVIFQNANMEFYMEKMGLIEKEIKLYDLLNELKKFSKHVWSAKCYFTRK--DL 133

  Fly   130 MIFEDLGEMDYAMV--RDRVLTHGEICGAYSKLAKFHALSMKIINERPEFV-KEFKDGICLVDIP 191
            .:.:::.:|.|..:  ..|.|...::......||..||.|:....::.:.: .||:..:..|.:.
  Fly   134 FVMQNVEDMGYVALPPGTRFLNENQMGPILKSLATLHASSIAYEKQQGKTIGVEFRKWLKEVSVD 198

  Fly   192 YMSSGMGPFKDFLGRIPELDRYKTHFEKI----EVHFIDRLRDIM-----KEY------------ 235
                            ||::.|.|....:    .:|     .|::     :||            
  Fly   199 ----------------PEVEWYTTGLRAVLAVAAIH-----PDVLDNPEAQEYIAQELPRCLDKV 242

  Fly   236 --QTNPQPGY-YVLCHGDYHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLM-- 295
              ..||.|.: .|..|.|....|:.  ::||....|..:|:|:|.|..:|.|.|.....|:.:  
  Fly   243 YCMVNPSPVHRNVFVHRDAWNANVF--YHKEKPHEERSILVDFQLCRYSPPAMDFHLVTYLNLEP 305

  Fly   296 -NREQRIGELETLLNYYFSVLRETLRKIG---YQGKLPDPPAFWKEMYR--LKDYEFLFLSTY-- 352
             :|::.||   :|:..|:..|.|..|::|   ||.:|.      |:.:.  |.|:. ||.:||  
  Fly   306 FSRKKMIG---SLIETYYDALAEEFREMGVNPYQEQLS------KQEFEQSLNDFS-LFGATYNC 360

  Fly   353 -------LPMSVGLSLETATNEETDDKLQDFIEEC 380
                   ||.:...:|:       |::.:||...|
  Fly   361 IAATVLRLPDNYLKNLK-------DERPEDFHRFC 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 56/291 (19%)
APH <202..320 CDD:279908 33/144 (23%)
CG33510NP_001014493.2 CHK 134..329 CDD:214734 45/220 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459883
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.