DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and CG33511

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster


Alignment Length:368 Identity:92/368 - (25%)
Similarity:162/368 - (44%) Gaps:39/368 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YASVIIRARVEYITQK---GFFSKSLIIKT--VLEMFAGSALFKTEIGMYRKVLPEFARILRENN 110
            |..:.:.|.|:...:|   .:|.|||..|.  ..|......:|:.|..:|.::||:..:..    
  Fly    46 YYKLHLEAEVKGDKKKYFLNYFIKSLPRKNEPQREECERKGVFQKESALYSQILPKIQKYA---- 106

  Fly   111 DTSRLYAECIYYSLEPSQVMIFEDLGEMDYAMVRDR---VLTHGEICGAYSKLAKFHALSMKIIN 172
             |.:||.:| |||  .:.:::.|||.: ||..:|..   .|.|.:|  ....|::.||.|  |..
  Fly   107 -TKKLYPKC-YYS--RNDILVLEDLTQ-DYRHLRANEYYTLDHYKI--VLEHLSELHAAS--IAW 162

  Fly   173 ERPEFVK---EFKDGICLVDIPYMSSGMGPFKDFLGRIPELDRYKTHFEKIEV-HFI-DRLRDIM 232
            |..|.||   .:|:  .|::: ::.|....:...|..|..|.....||:.::. :|| |:|.:::
  Fly   163 EEKENVKIYESYKN--VLIEL-HLDSNNSWYITGLKAIVFLAARNPHFQTMKAQNFIQDKLYNLL 224

  Fly   233 KEYQTNPQPG---YYVLCHGDYHTRNIMVKHNKESGGFED-CMLLDYQGCYVAPLAFDLMYSIYM 293
            .:.:....|.   ..||||.|....||:...||||....: |.::|:|.........|:::.:|:
  Fly   225 TKAEELVAPSKTIRNVLCHRDTWDHNIVYYFNKESSVLPNACCIVDFQLTQYCSPTLDVLFLLYI 289

  Fly   294 LMNREQRIGELETLLNYYFSVLRETLRKIGYQGKLPDPPAFWKEMYRLKDYEFLFLSTYLPMS-V 357
            :.:.|.|....:..|.:|:..|:..|.::|....|.....|.||..|.:....:..:...|.: :
  Fly   290 VASAEVRRAIYDECLEHYYKNLQHHLDRLGLDKNLITENNFRKECQRTRLAALVIWALTEPQTKM 354

  Fly   358 GLSLETATNEETDDKLQDFIEEC--KSILARF--ERSGYFENL 396
            ..|:......|..:|. |:...|  ..:|.|.  .:.||.|.:
  Fly   355 SPSISNRLRSEEPEKF-DYYLNCDRSELLLRVIEIQPGYEETI 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 75/289 (26%)
APH <202..320 CDD:279908 31/123 (25%)
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 75/288 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459890
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.