DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and CG5126

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster


Alignment Length:436 Identity:89/436 - (20%)
Similarity:165/436 - (37%) Gaps:112/436 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 EWLNEQFVTDVLRSHEKEPDLRVTKLDFTPGSAKGDNYASVIIRARVEYITQKGFFSKSLIIKTV 78
            :::....|.|:.::......|....::.:.|.   |.:.|.:....::.:..:...::.:::|.:
  Fly     9 DYIERHLVYDIFKNFGPSASLESHSVECSNGL---DGFMSALYTVTLDVVIAERKRTEVVLVKFM 70

  Fly    79 --LEMFAGSA----LFKTEIGMYRKVLPEFARILRENNDTSRLYAE-------CIYYS----LE- 125
              .|.|..|:    .|..||..|.::||.:..:||    ||.|.:|       |.|::    :| 
  Fly    71 KGTEEFRESSNSYIQFSNEIFAYAEILPAYENVLR----TSHLESEVVKNWVPCCYFARFGHVEG 131

  Fly   126 ----PSQVMIFEDLGEMDYAMVRDRVLTHGEICGAYSKLAKFHAL--SMKIINERPEFVKEFKDG 184
                ...|:..:.|....|.:.....|...::......:..||||  :.||:  :|......:.|
  Fly   132 LGNGRESVLALKHLKGDGYQLGPRLTLRRDQLEAMVGLVGPFHALGYATKIL--QPNVHARLRAG 194

  Fly   185 ICLVDIPYM-SSGMGPFKDFLGRIPELDRYKTHFEKIEVHF-----------IDRLRD------- 230
            :  ||:|:: |||.|.| |.|.|: ..||:...:::.:...           |:|||:       
  Fly   195 V--VDMPFVSSSGKGIF-DVLYRV-AFDRFYEFYDRQKEQLLQGADPGFGAAIERLREKYFKQPT 255

  Fly   231 -IMKEYQTN------PQPGYYVLCHGDYHTRNIMVKHNKESGGFED----CMLLDYQGCYVAPLA 284
             :::..:|:      |...:....||||:..|::..:     |.||    ...:|:|....:..|
  Fly   256 LLLERIRTSSFAEDQPDSHFATFLHGDYNRNNVLFHY-----GAEDKVDAIKAIDFQELRFSTTA 315

  Fly   285 FDLMYSIYMLMNREQRIGELETLLNYYFSVLRETLRKIGYQGKLPDPPAFWKEMYRLKDYEFLFL 349
            .||.:.:||....|.|......||..|...:.|.|.                             
  Fly   316 IDLSFFMYMNTPSEGRKEIYADLLRKYHRSMIEMLE----------------------------- 351

  Fly   350 STYLPMSVGLSLETATNEETDDKLQDFIEE--CKSILARFERSGYF 393
                     |.|....||.|||::...::|  .:...|.|:|..::
  Fly   352 ---------LVLRRNRNELTDDRVDQLLQEYSFERFNAHFKRYAFY 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 74/330 (22%)
APH <202..320 CDD:279908 32/146 (22%)
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 74/364 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.