DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and CG31974

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster


Alignment Length:406 Identity:78/406 - (19%)
Similarity:148/406 - (36%) Gaps:103/406 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GDNYASVI--IRARVEYITQKGFFSKSLIIK-------TVLEMFAGSALFKTEIGMYRKVLPEFA 103
            ||||.|::  ::|::. ....|.....||.|       ...::|.......||..:|:.:.||..
  Fly    36 GDNYGSIMLSVQAKIR-SADGGIRDLPLIAKLPPLTNDLYWQIFQPERTCITENAVYQYLSPELD 99

  Fly   104 RILREN--------NDTSRLYAECIYYSLEPSQVMIFEDLGEMDYAMVRDRVLTHGEICGAYSK- 159
            ::..|:        :...|.|...:......::|       :.|..:|::.|.|.|...|...: 
  Fly   100 KLQLESGILPAQIFDGFPRYYGSRVSLDNRATKV-------DRDAVLVQENVTTRGYRPGNRHRP 157

  Fly   160 ------------LAKFHALSMKIINERPEFVKEFKDGICLVDIPYMSSGMGPFKDFLGRIPELDR 212
                        ||::|||.:.:..::|:..:|:..       ||       ||.| .....:|:
  Fly   158 YNLAETVLILHYLAQYHALPIALRLKKPQVYEEYVR-------PY-------FKKF-DMNSNIDQ 207

  Fly   213 YKTHF--------------EKIEVHFIDRLRDIMKEYQTN---PQPGYYVLCHGDYHTRNIMVKH 260
            .:|..              ::.:|:.:..|.||.:.:|.:   ....:..|.|||....|:|:|:
  Fly   208 AETEIMNKEILKDIKLVTSDERDVNRVKELLDIFQAFQASNDVDDGPFTTLVHGDLWINNMMLKY 272

  Fly   261 NK--ESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRIGELETLLNYYFSVLRETLRKIG 323
            ..  |.|......::|:|......|..|:::.::..::...........|..|::...:|||.:.
  Fly   273 GMRGEEGTPLKVKIVDFQIAQYGSLVHDIIFVLFSSVDVNVLEDNFYNFLTIYYNAFIQTLRSVN 337

  Fly   324 YQGKLPDPPAFWKEMYRLKDYEF-LFLS-------TYLPMSVGLSLETATNEET---DDKLQDFI 377
            ..               ..:|.: |||.       ..||.::.:......:..|   |.|..||.
  Fly   338 VD---------------TSNYTYELFLEEVQQTAHVQLPHAIFMMKVILADNSTIPKDYKDVDFS 387

  Fly   378 -----EECKSILARFE 388
                 ...|:|:.:||
  Fly   388 VLTKNTGAKTIVTKFE 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 63/324 (19%)
APH <202..320 CDD:279908 24/136 (18%)
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 63/323 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459657
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.