DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and AgaP_AGAP003762

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_559537.2 Gene:AgaP_AGAP003762 / 3290900 VectorBaseID:AGAP003762 Length:405 Species:Anopheles gambiae


Alignment Length:416 Identity:117/416 - (28%)
Similarity:192/416 - (46%) Gaps:51/416 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DQLNVPEWLNEQFVTDVLRSHEKEPDLRVTK-LDFTPGSAKGDNYASVIIRARVEYITQKGFFSK 71
            |:|..|.|||::|..||:|....:|.:.:.| ....||:.|||:||||:.|..|.|.:|:....:
Mosquito     6 DELEAPGWLNDEFFRDVMRESNNDPTIELIKPCVLRPGTNKGDHYASVMFRTTVRYRSQRSSKEQ 70

  Fly    72 S--LIIKT-------VLEMFAGSALFKTEIGMYRKVLPEFARILRENNDTSRLYAECIYYSLEPS 127
            |  :|:||       ..|:.....||..||.||.|||||..|:|:|..:..: |...||.:|:|.
Mosquito    71 SVNIIMKTKPEADGLKKELLDDDRLFAIEIEMYSKVLPEMTRMLKEIGEEYK-YPRYIYGALKPR 134

  Fly   128 QVMIFEDLGEMDYAMVRDRVLTHGEICGAYSKLAKFHALSMKIINERPEFVKEFKDGICLVDIPY 192
            .::|.||:.:..:.|. :.:.|..::......:|.|||.|:.:.:....||......|.      
Mosquito   135 TILILEDISDQGWVMA-EFISTLDDMKPIVKDIAMFHAASVMLESADSTFVARHNYSIA------ 192

  Fly   193 MSSGMGPFKDFL----GRIPELDRYKTHFEKIEVHF---IDRLRDIMKEYQTNPQPGYY------ 244
             ...|| ||..:    |.:..|.|..:.|    .||   :.|.::.:..:.|    ..|      
Mosquito   193 -EKFMG-FKGMITKGFGDLMHLTRTCSEF----AHFARPLGRFQENLHNFFT----ALYIPSKTI 247

  Fly   245 --VLCHGDYHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRIGELETL 307
              ||.|||:|::|::.:.:.| |...:.:|||||.|.....|.||.|.:.|:..:|.:......|
Mosquito   248 QNVLIHGDFHSKNMLHQVDVE-GRHTNTILLDYQICCWTSPAVDLYYLLDMIPTQEVKDKYRSEL 311

  Fly   308 LNYYFSVLRETLRKIGYQGKLPDPPAFWKEMYR---LKDYEFLFLSTYLPM-SVGLSLETATNEE 368
            :..|:....:.|:::||.||:|.......|:.|   |:.:.:...|::..| ...:.:|.....|
Mosquito   312 IYMYYQQYSDLLKRLGYVGKIPSLLDLQIELVRYAGLELFHYAMFSSFRYMDQTAIDIEAYLKGE 376

  Fly   369 TDDKL---QDFIEECKSILARFERSG 391
            .::..   .:|.:...|.|.||...|
Mosquito   377 LENPAFNNPEFKKLMHSELTRFLHQG 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 85/300 (28%)
APH <202..320 CDD:279908 32/132 (24%)
AgaP_AGAP003762XP_559537.2 PKc_like 46..328 CDD:304357 85/300 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D279272at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11012
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.890

Return to query results.
Submit another query.