DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and AgaP_AGAP003760

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_559536.2 Gene:AgaP_AGAP003760 / 3290897 VectorBaseID:AGAP003760 Length:406 Species:Anopheles gambiae


Alignment Length:375 Identity:109/375 - (29%)
Similarity:173/375 - (46%) Gaps:48/375 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DQLNVPEWLNEQFVTDVLRSHEKEPDLRVTK-LDFTPGSAKGDNYASVIIRARVEYITQKGFFSK 71
            |:|..|.|||::|..||:|....:|.:.:.| ....||:.|||:||||:.|..|.|.:|:....:
Mosquito     5 DELEAPGWLNDEFFRDVMRESNNDPTIELIKPCVLRPGTNKGDHYASVMFRTTVTYRSQRSSEEQ 69

  Fly    72 S--LIIKT-------VLEMFAGSALFKTEIGMYRKVLPEFARILRENNDTSRLYAECIYYSLEPS 127
            |  :|:||       ..|:.....||..||.||.|||||..|:|:|..:..: |...|:.:|:|.
Mosquito    70 SANIIMKTKSEADGLKKELLDDDRLFAIEIEMYSKVLPEMTRMLKEIGEEYK-YPRYIFGALKPH 133

  Fly   128 QVMIFEDLGEMDYAM-------------VRDRVLTHGE---ICGAYSKLAKFHALSMKIINERPE 176
            .::|.||:.:..:.|             |:|..:.|..   :..|.|..|:.||.||.     .:
Mosquito   134 TILILEDISDQGWVMGDLINNLDDMKPIVKDIAMFHAASVMLESADSTFAERHAYSMS-----DK 193

  Fly   177 FVKEFKDGICLVDIPYMSSGMGPFKDFLGRIPELDRYKTHFEKIEVHFIDRLRDIMKEYQTNPQP 241
            ||.  .:|:       ::.|.|.......|.||.    .||.|....|.|.||::........:.
Mosquito   194 FVG--FEGM-------ITKGFGDLMHLTKRYPEF----AHFAKPLQKFQDSLRELYVSSYIQSKT 245

  Fly   242 GYYVLCHGDYHTRNIMVKHNKES-GGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRIGELE 305
            ...||.|||:|.:|::  |..:: |...|.:|||||.|.....|.|:.|.:.|:..::.:.....
Mosquito   246 IQNVLIHGDFHGKNML--HQVDAKGRHTDTILLDYQICCWTTPAVDVYYLLDMIPTQKVKDKHRS 308

  Fly   306 TLLNYYFSVLRETLRKIGYQGKLPDPPAFWKEMYRLKDYEFLFLSTYLPM 355
            .|:..|:....:.|:::||.||:|.......|:.|....|....:.:.|:
Mosquito   309 ELIYMYYQQYSDLLKRLGYVGKIPSLLDLQIELLRHSGLELFHYAIFSPI 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 86/302 (28%)
APH <202..320 CDD:279908 32/118 (27%)
AgaP_AGAP003760XP_559536.2 PKc_like 45..327 CDD:304357 86/302 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D279272at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11012
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.890

Return to query results.
Submit another query.