DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and AgaP_AGAP003758

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_310298.6 Gene:AgaP_AGAP003758 / 3290894 VectorBaseID:AGAP003758 Length:410 Species:Anopheles gambiae


Alignment Length:419 Identity:117/419 - (27%)
Similarity:178/419 - (42%) Gaps:62/419 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 EWLNEQFVTDVLRSHEKEPDLRVTKLDFTPGSAKGDNYASVIIRARVEYI---------TQKGFF 69
            ||::.::.|.||.:: ...|:.|.:.:...|...|.|:.|.|:||.|:|.         |:|   
Mosquito     9 EWIDREYFTRVLETY-LHADVAVQRYELAAGCPDGQNFMSAIVRATVDYTLASAEPQGRTEK--- 69

  Fly    70 SKSLIIKTVL---EMFAGS---ALFKTEIGMYRKVLPEFARILRENNDTSRLYAECIYYSLEPSQ 128
             .|||:||.|   |:..|:   .:|..|..:|..||.....:|....|.::.....||   |...
Mosquito    70 -VSLIVKTKLANPELAEGADQLNVFGIEKTVYGPVLKAVRELLTSYGDCTQFAPRFIY---EDEH 130

  Fly   129 VMIFEDLGEMDYAMVRDRV-LTHGEICGAYSKLAKFHALSMKIINERPEFVKEFKDGICLVDIPY 192
            .::.|||....|.....|. |....:..|..|||||||.:..:..:..:...      .|....:
Mosquito   131 ALVLEDLAVKGYRQPDRRARLDEPHLRLAVKKLAKFHAATAVLWRKNRDLFS------VLASSSF 189

  Fly   193 MSSGMGPFKDFLG-----------RIPELDRYKTHFEKIEVHFIDRLRDIMKEYQTNPQPGYYVL 246
            .|.| .|...|..           ::|||.||.........|.|:|   ..|.|::: :..:.||
Mosquito   190 ASEG-NPVHLFYANAIQHCIDQTEKVPELRRYTDDLRSFLEHAIER---EAKSYESD-ETCFTVL 249

  Fly   247 CHGDYHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNRE-QRIGELETLLNY 310
            .|||....|::.|::.| |...|.:::|||..:|...||||.:.:|...|.| ||.| .|.|:..
Mosquito   250 NHGDMWLNNLLWKYDAE-GTVSDVIMVDYQESFVGSPAFDLNHLLYSSANSEIQRAG-FEELVQL 312

  Fly   311 YFSVLRETLRKIGYQGKLPDPPAFWKEMYRLKDYEFLFLSTYLPMSVGLSLETATNE------ET 369
            |...||:.||:..|.|.|||......||...:|:..:..:..:|..:..:.|.||.|      |.
Mosquito   313 YTDELRDALRQFKYDGLLPDLARVQSEMATKRDHALIVTTCIVPPLILENSELATPENMLGDHEE 377

  Fly   370 DDKLQD-------FIEECKSILARFERSG 391
            ..:.:|       |||....:|.|...:|
Mosquito   378 AIRARDEIFSNPKFIEILSILLPRLMATG 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 88/304 (29%)
APH <202..320 CDD:279908 40/129 (31%)
AgaP_AGAP003758XP_310298.6 EcKinase 42..326 CDD:281023 88/303 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.