DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and CG7135

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster


Alignment Length:405 Identity:99/405 - (24%)
Similarity:180/405 - (44%) Gaps:54/405 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LADQLNVPE-WLNEQFVTDVLRSHEKEPDLRVTKLDFTPGSAKGDNYASVIIRARVEYITQKG-F 68
            ::|.|..|. :|..||....|....::.||:|..:..|..:..|:||.|.|.||:::|...:. .
  Fly     1 MSDALEEPPLYLTPQFFRRTLEHGLQQLDLQVIGVQLTNLTRGGENYCSNIYRAQIKYRNAESCA 65

  Fly    69 FSKSLIIKTVLE----MFAGSALFKTEIGMYRKVLPEFARILRENNDTSRLY--AECIYYS-LEP 126
            ...|||:|::.:    :.|...::..|...|..:.|:...::....|:...:  |...||| .:|
  Fly    66 METSLIVKSMPDEKQAILARLHIYNKETLFYMHIKPKLEALMWRAVDSFSAWTLAPKHYYSTTQP 130

  Fly   127 SQVMIFEDLGEMDYAM-VRDRVLTHGEICGAYSKLAKFHALSMKIINERPE-FVKEFKDGICLVD 189
            .|.:|.|||....|.: .|...|.........:|||::|||:|.:....|| .|..:..|:..:|
  Fly   131 EQTIILEDLCAAGYQLKCRQLGLDFDHAALVMAKLAEYHALTMVMAEREPETIVDRYPFGLLHMD 195

  Fly   190 I----PY----------MSSGMGPFKDFLGRIPELDRYKTHFEKIEVHFIDRLRDIMKEYQTNPQ 240
            .    |:          :::.:|..:.|.|...:|.||..||.:..:..:..||.          
  Fly   196 AINSEPFKLLFGTQLLKLAALVGDCEGFGGITTKLYRYHEHFTERVLKAVYPLRG---------- 250

  Fly   241 PGYYVLCHGDYHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMY----SIYMLMNREQRI 301
             .:.||.|||....||..|::.|. ..:...::|:|.|:...|.||:.|    |:.:.:.|::| 
  Fly   251 -NHNVLNHGDLWVNNIFFKYDAEY-TVQQVKIIDFQLCFYGSLGFDINYFLNTSLELEVLRDRR- 312

  Fly   302 GELETLLNYYFSVLRETLRKIGYQGKLPDPPAFWKEMYRLKDYEFLFLSTYLPM--SVGLSLETA 364
               :.|::.|:..|.:.|:.:.:..:||.......|:.:.:.|.|.....:.|:  .:|:..|  
  Fly   313 ---QELVDIYYRSLVDCLKHLPWSKELPSYEDIMDEIRKREAYGFFVAFGFFPLMSMIGVDSE-- 372

  Fly   365 TNEETDDKLQDFIEE 379
                 |:.|::|.:|
  Fly   373 -----DNSLKNFHDE 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 76/304 (25%)
APH <202..320 CDD:279908 31/121 (26%)
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 76/302 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459309
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.