DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and CG31102

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001262951.1 Gene:CG31102 / 326118 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster


Alignment Length:440 Identity:93/440 - (21%)
Similarity:171/440 - (38%) Gaps:79/440 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SLADQLNVPEWLNEQFVTDVLRSHEKEPDLRVTKLDFTPGSAKGDNYASVIIRARVEYITQKGFF 69
            |.:..:.:|.|:||.:...:|:...:| ..|:..|...|.:..|:.|.|:::|..::...:.||.
  Fly     9 SASSDVRIPAWINEAYFKRLLKREFRE-FRRILNLSIIPATPPGETYTSLLMRIVIDIELKDGFS 72

  Fly    70 -SKSLIIKTVLEMFAGSA-------LFKTEIGMYRKVLPEFARILRENNDTSRLYAECIY-YSLE 125
             .||.|:||:|:...|:.       :|..|..||..::|...::..|...:.:...:|.: ..::
  Fly    73 QQKSYIVKTMLDDAQGNGGFVNTLNIFPKEKMMYETIIPNLEQLYEEAGLSVKFAPKCHHAEDIK 137

  Fly   126 PSQVMIFEDLGEMDYAMVR-----DRVLTHGEICGAYSKLAKFHALSMKIINERPEFVKEFKDGI 185
            ....::.|||....|..:.     |....|..:    .|||:|||........:..|..:|:   
  Fly   138 GRICLVQEDLQTKKYRNINRLKGFDMAHMHRVL----EKLAEFHAAGAVWRQRKGPFPDDFQ--- 195

  Fly   186 CLVDIP--YMSS-----------------GMGPFKDFLGRIPELDRYKTHFEKIEVHFIDRLRDI 231
             .:.:|  |..|                 |:...:.::.|||..|::...:...           
  Fly   196 -RIYLPANYQKSKSYQARLQSYKTAIASWGLADHEQYVSRIPTADQFVQSYASC----------- 248

  Fly   232 MKEYQTNPQPGYYVLCHGDYHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMN 296
               :..|||. :.||.|||:.:.|||:.:. ::|.......:|:|.|.....|.||...|.....
  Fly   249 ---FNNNPQE-FKVLNHGDFWSSNIMLSYT-QTGDINQVRFVDFQLCKWGSPAQDLWELIICSAR 308

  Fly   297 REQRIGELETLLNYYFSVLRETLRKIGYQGKLPDPPAFWKEMY-RLKDYEFL-FLSTY------- 352
            ...||...:..:..|.:.|...|:.:.|..::|    ..:|:: .:..|.|. :.:|:       
  Fly   309 HSIRIQYFDYFIRIYHTHLVRCLKILKYSERIP----MLRELHMSMIKYGFWGYFTTFTHLVFIL 369

  Fly   353 LPMSVGLSLETATNE-ETDDKLQD-------FIEECKSILARFERSGYFE 394
            ||.....||...|.. |..|:.:.       ::....||.....|.|..:
  Fly   370 LPPDTEASLVKLTQPGEEGDRFRSKVYTNPLYVRSALSIFPFLLRRGILD 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 66/309 (21%)
APH <202..320 CDD:279908 27/117 (23%)
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 66/309 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459746
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.