DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and CG31099

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster


Alignment Length:418 Identity:96/418 - (22%)
Similarity:176/418 - (42%) Gaps:70/418 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VPEWLN----EQFVTDVLRSHEKEPDLRVTKLDFTPGSAKGDNYASVI-IRARV---EYITQKGF 68
            :|:|::    .|.|..||     |..:::|.:..:....:..|...:: |:.:|   ::..:|.|
  Fly     6 IPDWVSSLSLNQAVHSVL-----EDGVQITSVIPSVHLIQFRNCTVLLPIQVKVQLRDFTMKKLF 65

  Fly    69 FSKSLIIKTVLEMFAGSAL--FKTEIGMYRKVLPEFARILRENNDT----SRLYAECIYYSLEPS 127
            |.......|.::....:.|  |:.|..:|..|||:...|.||....    .|.:.  :.||: ..
  Fly    66 FLLKAQHGTDIQAMVMNQLKMFQREHQVYHNVLPKLEEIYREVGKKVSFGPRAFR--LDYSI-GV 127

  Fly   128 QVMIFEDLGEMDYAMVRDRVLTHGEIC--GAYSKLAKFHALSMKIINERPEFVKEFKDGICLVDI 190
            |.::.|||....|..| :|.....::|  ....|||:|||.|...:.:...|.....:|:     
  Fly   128 QYVLLEDLKAKSYKNV-ERQAGFNKLCLKQVLKKLAQFHAASAVCVEKHGAFSNLLVNGV----- 186

  Fly   191 PYMSSGMGPFKD------FLGRIPELDRYK--THFEKIEVHFIDRLRDIMKEYQTNPQPG---YY 244
             |..:.....::      ||.   :|.|::  .||.|   ..:::.:|::........|.   :.
  Fly   187 -YTKANESVLQELNDPEIFLS---QLRRWRLGDHFHK---RLVEKEKDLVDGLLKLHSPDSNEFN 244

  Fly   245 VLCHGDYHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRIGELETLLN 309
            ||.|.|....|:|.|.: :||..||..|||||.......|.||.|:|.....::.::.:.:.::.
  Fly   245 VLNHSDCWVNNVMFKFD-DSGHVEDTALLDYQLVKYGSPAIDLYYTILSSAEKDIKLAQFDNMVQ 308

  Fly   310 YYFSVLRETLRKIGYQGKLPDPPAFWKEMYRLKD-------YEFLFLSTYLPMSVGLSLETATNE 367
            |||..|.:.|:.:.:.|.||       ::..::|       ..::.::..||:::....|...||
  Fly   309 YYFYHLLDNLKALNFGGSLP-------QLQHIRDALNKNGLAAYVVVTRALPITMMNQFEDEVNE 366

  Fly   368 ETDDKL-------QDFIEECKSILARFE 388
            ....|:       :.:|:..|.||...|
  Fly   367 RYASKMKCAMFTSRKYIQAIKDILPWME 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 73/299 (24%)
APH <202..320 CDD:279908 34/128 (27%)
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 72/295 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459809
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.