DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and CG31380

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_733121.1 Gene:CG31380 / 318701 FlyBaseID:FBgn0051380 Length:405 Species:Drosophila melanogaster


Alignment Length:432 Identity:103/432 - (23%)
Similarity:168/432 - (38%) Gaps:89/432 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 WLNEQFVTDVLRSHEKEPDLRVTKLDFTPGSAKGDNYASVIIRARVEYITQKGFFSKSLIIKTVL 79
            ||..:::...||.:.:..:|||..:...|...||:||.:::.|..:.|   .....:.||.||||
  Fly     4 WLTAEYLEAALRRYYQNNELRVESMVINPALGKGENYGAILTRIHLVY---SSIVEEHLIAKTVL 65

  Fly    80 E--------MFAGSALFKTEIGMYRKVLPEFARILRENNDTSRLYAECIYYSLEPSQVMIFEDLG 136
            |        ..|...::..|:.:|.:|||:...:..|     :|..:.::...:.. .:|.|||.
  Fly    66 EYEDAETKMKKAPYDIYNRELEIYEQVLPKLQELAGE-----QLCPKILHIDRQRG-ALIMEDLS 124

  Fly   137 EMDYAMV-RDRVLTHGEICGAYSKLAKFHALSMKIIN---ERPEFVKEFKDGICLVDIPYMSSGM 197
            ...:.|. |.:.|....:.....||||..|.|..:.|   |....:.|:..|       :.:...
  Fly   125 YKGFVMAPRLQRLDEQHVSLVLRKLAKMQAASAVLENNLLENNFSLTEYDKG-------FFNRYT 182

  Fly   198 GPFKD-FLGRIPELDRY-KT-----HFEKIEVHFIDRLRD--------IMKEYQTNPQPGYYVLC 247
            ..|.. |||.:.....| ||     |..|:    :|.|..        ..|:.||:    ..||.
  Fly   183 ESFSAYFLGCLKSCANYLKTQAGYEHHAKL----LDELAPYYMGLGLRCFKQEQTH----INVLT 239

  Fly   248 HGDYHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNR---EQRIGELE-TLL 308
            |||..|.|:|.|:  |:|...|.:|:|:|..:......|    |:.|:|.   ||...||: .:.
  Fly   240 HGDLWTNNMMFKY--EAGVPSDVLLIDFQYAFWGSPTLD----IHHLLNTSAVEQVRSELQMKMR 298

  Fly   309 NYYFSVLRETLRKIGYQG-KLPDPPAF-----WKEMYRL---------------KDYEFLFLSTY 352
            ..|..|....|:::|::| :||....|     .|..|.:               .|.:|..|.:.
  Fly   299 GVYHDVFVGELQRLGFKGQRLPSRKQFHLESEQKRFYAVHCGLLLLPVLLNTDETDADFAALLSD 363

  Fly   353 LPMSVGLSLETATNEETDDKLQDFIEECKSILARFERSGYFE 394
            .|..:.:......|....|.:       |.::..||..|..:
  Fly   364 QPRGMDMKRRLYLNPGIQDSI-------KQMVKHFELEGLLD 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 78/307 (25%)
APH <202..320 CDD:279908 38/136 (28%)
CG31380NP_733121.1 EcKinase 36..314 CDD:281023 78/307 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459564
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.