DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and CG31288

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_733094.1 Gene:CG31288 / 318664 FlyBaseID:FBgn0051288 Length:428 Species:Drosophila melanogaster


Alignment Length:377 Identity:90/377 - (23%)
Similarity:163/377 - (43%) Gaps:47/377 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DQLNVPEWLNEQFVTDVLRSHEKEPD-LRVTKLDFTPGSAKGDNYASVIIRARVEYITQKGFF-S 70
            :.|.:|:|:||::...||.  :.||| ::|.|.........|:|:.|.::|..::...:.|.. :
  Fly    12 EHLIIPDWINEKYFESVLA--KDEPDHVKVLKFTVVAAIPPGENFTSTMLRVYIKLEMKDGSVKT 74

  Fly    71 KSLIIKTVL-EMFAGS-----ALFKTEIGMYRKVLPEFARILRENNDTSRLYAECIYYSLEPSQV 129
            |:.|.||:| |...||     .||..|..||:..||.|..:.::.....:|..:|::.......:
  Fly    75 KTYIFKTMLPEERGGSDINEFGLFPKEAMMYKTYLPAFEALYKDVGWDIQLAPKCLHTEEREGDI 139

  Fly   130 -MIFEDLGEMDYA-MVRDRVLTHGEICGAYSKLAKFHALSMKIINERPEFVKEFKDGICLVDIPY 192
             .|||||....:. |.|.:.|....:.....|||::||.|.........:..||.:|....|:..
  Fly   140 HFIFEDLCVKRFKNMDRTKGLDMEHMTKCLQKLAEYHAASAVYEELHGPYPSEFSEGFVKKDVKK 204

  Fly   193 MSSGMGPFKDFLGR-------IPELDRYKTHFEKIEVHFIDRLRDIMKEYQTNPQPGYYVLCHGD 250
            ........|:...:       :.:.|:|...|..::.::...|..:    :.||.. ::||.|||
  Fly   205 FHVDGFQLKEKAYKKAMLSWGLKDADKYIKAFPTVKQYWAQCLSTL----ELNPDE-FHVLNHGD 264

  Fly   251 YHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRIGELETLLNYYFSVL 315
            :.:.|:|..:..: |..|..:|:|:|.......|.||::.:.:....:.||.|.:..:..|:..|
  Fly   265 FWSSNLMSSYLPD-GTLEKLILIDFQIVMWGSPAMDLLFFLTLSPTNDLRIKEFDHFVRIYWERL 328

  Fly   316 RETLRKIGYQGKLPDPPAFWKEMYRLKD------------YEFLFLSTYLPM 355
            .|.|:.:..:..||          :|:|            |.|..:..:||:
  Fly   329 VECLKVLKLKKPLP----------KLRDLQNSMNNKNHSFYAFFSILNHLPI 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 70/292 (24%)
APH <202..320 CDD:279908 27/124 (22%)
CG31288NP_733094.1 EcKinase 50..331 CDD:281023 68/286 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459732
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.