DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and CG2004

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster


Alignment Length:362 Identity:79/362 - (21%)
Similarity:140/362 - (38%) Gaps:70/362 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SLADQLNVPEWLNEQFVTDVLRSHEKEPDLRVTKLDFTPGSAKGDNYASVIIRARVEYI--TQKG 67
            |.||   :....:|..:.:::|:   ....|.|...|.|...|||.|.|.:.|..:..:  .::|
  Fly     6 SFAD---ISAKFSEATLDEIIRN---AGGTRHTSYKFGPSGKKGDAYLSRVFRITIYGVKEAEEG 64

  Fly    68 FFSKSLIIKTVLE----------MFAGSALFKTEIGMYRKVLPEFARILRENNDTSRL----YAE 118
            ...|.|.|..:::          :|.....|:.||..|.||||......:......:.    |..
  Fly    65 QDEKQLEISVIVKAMPDNLHRRRLFRSVIFFRNEINFYTKVLPAIEAFQKSRQPAPKKPFVEYPR 129

  Fly   119 CIYYSLE-PSQVMIFEDLG--------EMDYAMVRDRVLTHGEICGAYSKLAKFH--ALSMKIIN 172
            |:....: .:..:..||:|        ..||..:.|.:||       ...|.:||  ||:...::
  Fly   130 CLASLCDGVNDFIALEDVGPRGYRAPVRQDYISLEDALLT-------MRTLGRFHGVALAFNALD 187

  Fly   173 ER--------------PEFVKEFKDGICLVDIPYMSSGMGPFKDFLGRIPELDRYKTHFEKIEVH 223
            .:              .|..:|:..|..|:       ......|.:.:|....:|:|    :..:
  Fly   188 SKNFEKAAGSLEETYYGEHTREWYTGFLLL-------AENVATDAVKQIYPNSKYET----VATN 241

  Fly   224 FID--RLRDIMKEYQTNPQPGYYVLCHGDYHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFD 286
            |:.  ...|::....|..:  ..|..|||..|.|.:.|:| |.|..|:.:::|:|....:.||.|
  Fly   242 FLQPPLFDDLINLVSTRSK--LSVFGHGDCWTPNFLTKYN-ERGQSEEIIIIDFQLARCSSLALD 303

  Fly   287 LMYSIYMLMNREQRIGELETLLNYYFSVLRETLRKIG 323
            |.:.||...::|.|....:.||..|....::.::.:|
  Fly   304 LSFFIYSCTSQELREQHYDELLRAYLESAQDLIQDLG 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 70/320 (22%)
APH <202..320 CDD:279908 31/119 (26%)
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 69/318 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.