DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and CG32195

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001262006.1 Gene:CG32195 / 317907 FlyBaseID:FBgn0052195 Length:401 Species:Drosophila melanogaster


Alignment Length:417 Identity:115/417 - (27%)
Similarity:170/417 - (40%) Gaps:66/417 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EQFVTDVLRSHEKEPDLRVTKLDFTPGSAKGDNYASVIIRARVEY--ITQKGFFSKSLIIKTVLE 80
            |.|...:.|::..|. |||........|.||:|:.|||.|..:.:  .......|...|:|.:|.
  Fly     9 EYFERALARAYGCEM-LRVENFHIKAVSQKGENFCSVIYRVALVFRRSPDGALESGKYILKDLLP 72

  Fly    81 MFAGSALFKTEIGMYRKVLPEFARILRE---NNDTSRLYAECIYYSLEP-SQVMIFEDLGEMDYA 141
              |.:||...|..|:..:||....||.|   .....:|.|:|:...:.. .::.|.||||.:.|.
  Fly    73 --AAAALGTNEKDMFEVLLPAMQAILEEAPKEIGEHKLSADCLLVEISAGKELYILEDLGALGYE 135

  Fly   142 MVRDRV---LTHGEICGAYSKLAKFHALSMKIINERPEFVK-------------EFKDGICLVDI 190
            ....|.   |...:||  ..|||:||..|..:..::||.::             .|...:.|...
  Fly   136 SFDRRQGLNLEEAKIC--VRKLAQFHGASKVLYEKKPELIQRLSPSHYANGLNDRFAQALVLEGA 198

  Fly   191 PYMSSGMGPFKDFLGRIPELD-RYKTHFEKIEVHFIDRLRDIMKEYQTNPQPGYYVLCHGDYHTR 254
            .|.:..      |...:||:. :.|....|.   :..|:||::...:::    ...:.|||....
  Fly   199 EYAAEA------FAEELPEISKKMKAQIPKA---YTKRMRDVVDPNKSS----LNAVIHGDPWLN 250

  Fly   255 NIMVKH-NKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRIGELETLLNYYFSVLRET 318
            |||... ||::      .|:|:|.||....|.||.:..|..:..|..:...:.||||||..|.||
  Fly   251 NIMFDFVNKKA------TLVDFQNCYWGSPAIDLYFLFYTSLKPELLLNNQDELLNYYFDNLLET 309

  Fly   319 LRKIGYQGKLPDPPAFWKEMYRLKDYEFLFLSTYLPM-------SVGLSLETATNEETDDKL--- 373
            ||..||:..||.......||.|...|.:..:...||:       ||...:.|..  :||..|   
  Fly   310 LRHCGYKDTLPTFGQLKDEMKRCLFYGYYTVVCELPICCASPEASVDFGVHTFV--DTDAMLKKR 372

  Fly   374 -QDFIEE-----CKSILARFERSGYFE 394
             |.|..|     .|:.|..|:|.|..|
  Fly   373 HQLFASERVRQTIKATLLMFDREGILE 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 82/300 (27%)
APH <202..320 CDD:279908 35/119 (29%)
CG32195NP_001262006.1 EcKinase 37..315 CDD:281023 82/300 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459585
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.