DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and CG13360

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_569859.1 Gene:CG13360 / 31025 FlyBaseID:FBgn0025620 Length:421 Species:Drosophila melanogaster


Alignment Length:426 Identity:104/426 - (24%)
Similarity:178/426 - (41%) Gaps:63/426 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PEWLNEQFVTDVLRSHEKEPDLRVTKLDFTPGS-AKGDNYASVIIRARVEYITQK-------GFF 69
            |::|||.|....|....::..:.:.|:.|:..| ..|:||.|.|.||:..|.:.|       ...
  Fly    15 PKYLNEDFFKAALEDGLRDMRVDIKKIIFSESSGGGGENYCSKIYRAKALYRSSKRQLDEELALI 79

  Fly    70 SKSLIIKTVLEMFAGSALFKTEIGMYRKVLPEFARILRENNDTSRLYAECIYYSLEPSQVMIFED 134
            .||:.|....:.....|::..|...|..||.:...::   .|.|:..|:|:|.:.||.|.::|:|
  Fly    80 VKSIAITPATQFLEELAVYLREKIFYFDVLGKLEVLI---GDGSKFGAKCLYTTREPIQTIVFDD 141

  Fly   135 LGEMDYAMVRDRVLTHGEICGA-YSKLAKFHALSMKIINERPEFVKEFKDGICLVDIPYMSSGMG 198
            |.:..|.:...:...:.|.|.. ..||.||||.||.:..:.|...:.|..|  ::|..|:.:. .
  Fly   142 LTQYGYKLASRQSGLNEEHCVVILKKLGKFHASSMVLAEKEPSVREHFTTG--MLDENYIRTN-E 203

  Fly   199 PFKDFL--------GRIPELDRYKTHFEKIEVHFIDRLRDIMKEYQT---NPQPG-YYVLCHGDY 251
            .|.:|:        ..:.:...|:...||:..|.     |.:||...   .|.|| ..||.|||.
  Fly   204 RFINFMTLQCRTLANVVSKWPGYELLAEKLHRHC-----DNIKENLVTTGRPLPGEITVLNHGDL 263

  Fly   252 HTRNIMVKHNKESGGFE-DCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRIGELETLLNYYFSVL 315
            ...|.|.|::.|..... |.:.:|:|..:......|:.:.:...:..:..|...|.|:..|::.|
  Fly   264 WVNNFMYKYDDEQPTKPIDAIFVDFQNSFFGSPGCDINFFLNSSVQLDVLIHRREFLIQTYYASL 328

  Fly   316 RETLRKIGYQGKLPDPPAFWKEMYRLKDYEFLFLSTYLPM-------SVGLSLET---------- 363
            |::|.:: :...:|......:|:...:.|.|.....:|||       |..:|:|.          
  Fly   329 RDSLERM-HSAFVPSYADIQQEIRARELYGFFSSYAFLPMVTMKKEDSYDISIEALSDQDFAKKK 392

  Fly   364 -----ATNEETDDKLQDFIEECKSILARFERSGYFE 394
                 ::|..|.|.|       :..|.||:..|.|:
  Fly   393 VQLMFSSNPRTTDTL-------RYALRRFDDLGIFD 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 76/297 (26%)
APH <202..320 CDD:279908 30/130 (23%)
CG13360NP_569859.1 EcKinase 50..335 CDD:281023 76/295 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459295
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.