DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and CG33301

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster


Alignment Length:412 Identity:108/412 - (26%)
Similarity:178/412 - (43%) Gaps:62/412 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VPEWLNEQFVTDVLRSHEKEPDLRVTKLDFTPGSAKGDNYASVIIRARVEYITQKG-FFSKSLII 75
            :|.||...::...||::.::..|:|.::...|.:.||:|:..|:.|..|:|....| ..:|:.|:
  Fly     2 LPTWLTAAYLQPRLRAYCQDDRLQVLRIWAKPATGKGENFVGVMTRIYVDYQLGDGSVVNKTYIV 66

  Fly    76 KTVL-------EMFAGSALFKTEIGMYRKVLPEFARILRENNDTSRLYAECIYYSLEPSQVMIFE 133
            |..|       |:|....|:..|:.||..:||:...:|:|.....:|.|:.|....| ...||.|
  Fly    67 KQALSAEVPQAEVFFEYELYTREMDMYEFILPKLKELLQEAGLDQKLTADAITVDRE-YNTMILE 130

  Fly   134 DLGEMDYAMVR-DRV----LTHGEICGAYSKLAKFHALSMKIINERPE----------FVKEFKD 183
            ||.  .|..|. |||    :.|.|:  ....||||||.|:.:....|.          |.::.| 
  Fly   131 DLA--PYKFVNADRVKQLDMAHTEL--TLEMLAKFHAASIVLQERHPNLLTKCFYTHFFSRDKK- 190

  Fly   184 GICLVDIPYMSSGMGPFKDFLGRI---PEL-DRYKTHFEKIEVHFID---RLRDIMKEYQTNPQP 241
                   .|.....|.||.||..|   |.| :.|.....|:..|.::   |..|:       .:.
  Fly   191 -------AYSVVFAGLFKAFLRFIDGQPNLKEAYGDKLHKLRTHIMEYGARAYDV-------GES 241

  Fly   242 GYYVLCHGDYHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRIGELET 306
            ....|.|||..|.|||.::: ::|.....:.:|:|.........||.|  :...:..:.:|:.|:
  Fly   242 DLKTLNHGDCWTTNIMFQYD-DAGEPRSVVAIDFQFSNCTSPTIDLHY--FFTTSLREEVGDKES 303

  Fly   307 -LLNYYFSVLRETLRKIGYQGKLPDPPAFWKEMYRLKDYEFLFLSTYLPMSVGLSLETATNEETD 370
             |:.:::..|:..|.|..|:|.||.     .:.|||:.....|:|....|.....:... :|||.
  Fly   304 ELVEHHYKALKANLEKFSYKGSLPT-----LQEYRLQFERRRFMSLLAHMFKPCMIYNG-SEETS 362

  Fly   371 DKLQDFIEECKSILARFERSGY 392
            |....:.|..:.:  |:::|.|
  Fly   363 DFSSLYAESPEGL--RYQKSVY 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 82/307 (27%)
APH <202..320 CDD:279908 28/125 (22%)
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 82/307 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459543
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.