DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and T16G1.3

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_506237.2 Gene:T16G1.3 / 188553 WormBaseID:WBGene00011797 Length:389 Species:Caenorhabditis elegans


Alignment Length:369 Identity:82/369 - (22%)
Similarity:142/369 - (38%) Gaps:61/369 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 GFFSKSLIIK---TVLEMFAGSAL---FKTEIGMYRKVLPEFARILRENNDTSRLYAECIY--YS 123
            ||.|:.::::   ||    .|..|   |..:|.....||....::..::...|.|::...|  ..
 Worm    21 GFMSRVILVEPDWTV----HGEHLPNRFVLKITSCMHVLNVLDQMNLQDKSESALWSIFEYEAQG 81

  Fly   124 LEPSQVMIFEDLGE--MDYAMVRDRV----------LTHG----------------------EIC 154
            |...:|.::|.:|:  ||..::..:|          ||.|                      |:.
 Worm    82 LHNREVNLYEIIGKWNMDDVLMSPKVFFSKKFDSENLTKGFFAMEYVDNAITRHLYINLKSYELH 146

  Fly   155 GAYSKLAKFHALSMKIINERPEFVKEFKDGICLVDIPYMSSGMGPFKDFLGRIPELDRYKTHFEK 219
            .....||.|.|.|:|:.....|.|..: |...:|...:..:|:....:.:.:|.: :......:|
 Worm   147 SILKSLAVFQAESLKLNKREQESVTGY-DLEKIVGKMFSQNGLNSIFEQVRQINK-EELSEAADK 209

  Fly   220 IEVHFIDRLR-DIMKEYQTNPQPGYYVLCHGDYHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPL 283
            |.|..::.:. |::|...........||.|||..:.|||.|.||:.  |....::|||..::...
 Worm   210 IAVFGVELVNFDLVKNLNNYLGIKKNVLVHGDLWSANIMWKENKDE--FRVDKIIDYQSIHLGNP 272

  Fly   284 AFDLMYSIYMLMNREQRIGELETLLNYYFSVLRETLRKIGYQGKLPDPPAFWKEMYRLKDY---- 344
            |.||:......::..:|....|.||..::....|.|.    ...:|......||.|||  |    
 Worm   273 AEDLVRLFISTLSGSERQKYWEKLLEQFYEYFIEALE----DKNVPYTLEQLKESYRL--YFVTG 331

  Fly   345 EFLFLSTYLPMSVGLSLETATNEETDDKLQDFIEECKSILARFE 388
            ..|.|..:.|::.....|.:..:|.....:...|:.|.:|...|
 Worm   332 SLLMLPMFGPIAEVKLAEMSDPDEVKKYREILTEKTKRLLNDME 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 66/299 (22%)
APH <202..320 CDD:279908 29/118 (25%)
T16G1.3NP_506237.2 PKc_like 1..381 CDD:389743 82/369 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.