DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and H06H21.8

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001023255.1 Gene:H06H21.8 / 186700 WormBaseID:WBGene00019164 Length:388 Species:Caenorhabditis elegans


Alignment Length:273 Identity:63/273 - (23%)
Similarity:110/273 - (40%) Gaps:45/273 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 MIFEDLGEMDYAMVRDRVLTHGEICGAYSKLAKFHALSMKIINERPEFVKEFKDGICLVDIPYMS 194
            ::.|:|.|..:|:.....|.|.:|......||..|:..||  .:...:|:.|.:|         :
 Worm   129 IVAENLSEKVFAVEHIPGLKHEQILRLMEALAGLHSFLMK--RDDKSYVESFVEG---------A 182

  Fly   195 SGMGPFKDFLGRIPELDRYKTHFEKIEVHFIDRLRDIMKEYQTNPQ-----------PGYYVLCH 248
            .|...|.:.:..:...:.........||...||:|:|...:..:.:           ||  ::||
 Worm   183 HGRETFSEGMQNMMFEEALTLENVSPEVFGNDRIRNIKWSFDYSIKNKATADAISAFPG--IICH 245

  Fly   249 GDYHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRIGELETLLNYYFS 313
            .|.:..|::.|  |:|...|...::|||..::..:|||::..:.:.:|||.|....:..|::|..
 Worm   246 ADLNVTNVLWK--KDSAKDEISAIIDYQMLFIGSIAFDIIRVLTLGLNREIRRKMTQNYLDHYHK 308

  Fly   314 VLRETLRKIGYQGKLPDPPAFWKEMYRL-----KDYEFLFLSTYLPMSVGLSLETATNEETDDKL 373
            .|.|.     ..||.|.........|.|     .::....::.|:.|   .|..|..|.|     
 Worm   309 TLTEL-----SNGKAPFSMEELLHQYSLIYPFSSNFSLFGIALYIKM---YSDGTLGNPE----- 360

  Fly   374 QDFIEECKSILAR 386
             |..|.||.::.|
 Worm   361 -DKEENCKELIDR 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 47/204 (23%)
APH <202..320 CDD:279908 30/128 (23%)
H06H21.8NP_001023255.1 CHK 129..312 CDD:214734 46/197 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I7662
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I4083
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto19975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.