DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and F56A4.5

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_503669.1 Gene:F56A4.5 / 186348 WormBaseID:WBGene00018913 Length:418 Species:Caenorhabditis elegans


Alignment Length:181 Identity:36/181 - (19%)
Similarity:71/181 - (39%) Gaps:41/181 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LRSHEKEPDLRVTKLDFTPGSAKGDNYASVIIRARVEYITQKGFFSKSLIIKTVLE--------- 80
            ::|:.|..:|...||...    .||.:.|.::....|:        .:|::|.:::         
 Worm   252 IKSYSKVSELLGFKLVLN----HGDLWQSNMLHCLDEH--------GNLVLKAIIDWQGVSMLPP 304

  Fly    81 --------MFAGSALFKTEIG-----MYRK----VLPEFARILRENNDTSRLYAECIYYSLEPSQ 128
                    |...:|..:.|.|     :|.:    ::.|....|.|..|:..||...:..:|.|..
 Worm   305 GLDLARLLMGCLTAYERRERGAELLMLYHQTFTGIVGEELFSLEELQDSYNLYYPIMTLTLVPMV 369

  Fly   129 VMIFEDLGEMDYAMVRDRVLTHGEICGAYSKLAKFHALSMKIINERPEFVK 179
            ..:||:....:....:.|:.|.|::......|.|.|..::|   :.|:|:|
 Worm   370 SSLFENSEMSEVEKTQARLKTEGKLFALLEDLVKVHEQNVK---KFPDFLK 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 31/159 (19%)
APH <202..320 CDD:279908
F56A4.5NP_503669.1 DUF1679 3..409 CDD:369592 32/168 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.