DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and F20D6.5

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_505104.3 Gene:F20D6.5 / 184724 WormBaseID:WBGene00017635 Length:376 Species:Caenorhabditis elegans


Alignment Length:413 Identity:79/413 - (19%)
Similarity:154/413 - (37%) Gaps:102/413 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TKLDFTPGSAKGDNYASVIIRARVEYI-TQKGFFSKSLIIKTVL-EMFAGSALFK---------- 89
            ::|.|..|.|..:..|...:   ||.: |.||..|   .::.|. |.:.|:.:.|          
 Worm     3 SELAFCYGKAIEEMVAEFKV---VEDVGTGKGMLS---CVQLVFEEQYGGNVILKIPGAEAARSR 61

  Fly    90 -------------TEIGMYRKVLPEFARILRENNDTSRLYAECIYYSLEPSQVMIFEDLGEMDYA 141
                         ||:..|        ..|::.:|.:..|.:  .|.||...:.: :.:.:....
 Worm    62 LFIGDDTFCKLHNTEVDAY--------TFLQKFSDKNISYPK--IYELEKMDISV-DPIKQGHII 115

  Fly   142 MVRDRVLTH---------GEICGAYSKLAKFHALSMKIINERPE--------------FVKEFKD 183
            |.....:||         .|:......||:||::..::..|...              |.::.|:
 Worm   116 MEYMSGITHLYCYNNLKPDELIEPVKNLARFHSIGAELDEEEGSNVPRDFLSSWFTTLFTQQNKN 180

  Fly   184 GICLVDIPYMSSGMGPFKDFL------GRIPELDRYKTHFEKIEVHFIDRLRDIMKEYQTNPQPG 242
                   .::.:..|...|:|      ..|.|||...|....::::...:|..:.:         
 Worm   181 -------TFIGNWKGDLSDWLPSKVARDTIKELDGLLTPEIFLKLNNDCQLTGVQE--------- 229

  Fly   243 YYVLCHGDYHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRIGELETL 307
              |||||||...|::.:.:.: |.::...::|:|.......|.||.......|:.:.|....:.|
 Worm   230 --VLCHGDYSFHNLLYEKHCD-GSYKFRAIVDFQSVNWGNAAQDLSRLFVTAMSGKDRRDSEDRL 291

  Fly   308 LNYYFSVLRETLRKIGYQGKLPDPPAFWKEMYRLKDYEF-LFLSTYLPMSVGLSLETATNEETDD 371
            |..|:    :.|.|:. :|.:  .|..|:::.:.....| |..:....::.||.|.|.:.:....
 Worm   292 LKIYY----DELIKVS-KGNV--APFTWEQLKQSYTRFFQLHAAIVCTVTPGLFLVTLSGKHEGK 349

  Fly   372 KLQDF----IEECKSILARFERS 390
            :..:|    ||:...:|...:|:
 Worm   350 EKVEFRNIMIEKYVGLLEDIQRN 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 61/330 (18%)
APH <202..320 CDD:279908 27/123 (22%)
F20D6.5NP_505104.3 PKc_like 11..369 CDD:389743 75/400 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.