DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and E02C12.12

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_505432.2 Gene:E02C12.12 / 183991 WormBaseID:WBGene00017097 Length:200 Species:Caenorhabditis elegans


Alignment Length:187 Identity:36/187 - (19%)
Similarity:70/187 - (37%) Gaps:49/187 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KLDFTPGSAKGDN-----------YASVIIRARVEYI-TQKG------FFSKSLIIKTVLEMFAG 84
            :|.|...:..|||           :.|:|.....::| .:||      |..|   |.|.|.:...
 Worm     2 QLSFGTYATFGDNMKATNISDLKGFQSIIALIEPDWIDVEKGKDLPKKFAVK---ISTQLALAVL 63

  Fly    85 SALFKT--EIGMYRKVLPEFARILRENND----TSRLYAECIYYSLEPSQV-------------- 129
            |.:.|.  |.|...:.|.|..:::|:.::    |.:|..:..:..:..::|              
 Worm    64 SKIMKLGGENGFSEEKLNELGKLIRDGHNREVATYKLLEKMNHPDIPYTKVYGLKGYSDANDLKG 128

  Fly   130 -MIFEDLGEMDYAMVRDRVLTHGEICGAYSKLAKFHALSMKIINER------PEFVK 179
             ||.|.:..:....:.:.:|. .::......:|.|.||...:..|.      ||:::
 Worm   129 FMIMEFIPNVRSIPMYEAILA-DDLISLVRGIATFAALGETLSEEEKAFAGGPEYLE 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 34/178 (19%)
APH <202..320 CDD:279908
E02C12.12NP_505432.2 PKc_like 1..>200 CDD:304357 36/187 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.