DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and C29F7.1

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001379235.1 Gene:C29F7.1 / 183016 WormBaseID:WBGene00007810 Length:394 Species:Caenorhabditis elegans


Alignment Length:448 Identity:86/448 - (19%)
Similarity:150/448 - (33%) Gaps:138/448 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NVP---EWLNEQFVTDVLRSHEKEPDLRVTKLDFTP--GSAKG--DN----YASVIIRARVEYIT 64
            |.|   |||               .||...|:...|  ||. |  ||    :.|:|.:.::.:..
 Worm     8 NYPLTKEWL---------------ADLVKKKIGVKPKVGSC-GILDNADLGFMSMIRKVQLHFDA 56

  Fly    65 QKGF----FSKSLIIK------------------------TVLEMFAGSALFKTEIGMYRKVLPE 101
            ::..    ..|:::||                        .::|:|    :..||...|      
 Worm    57 EQELKHPNLPKNVVIKIASCAKLGEGVGSVGVDVNKGNAAAIMELF----MHNTECNYY------ 111

  Fly   102 FARILRENNDTSRLYAECIYYSLE--------PSQVM-IFEDLGEMDYAMVRDRV--LTHGEICG 155
              .:.|:..|.. :....||.:.:        |..|| :|||      ..|.|.:  ....::..
 Worm   112 --NVFRKYTDLP-MKVPVIYCAAKAGDAEAPVPVIVMEMFED------CTVHDLIDGFDKDQLFK 167

  Fly   156 AYSKLAKFHALSMKIINERPEFVKEFKDGICLVDIPYMSSGMGPFKDFLGRIPELDRYKTHFEKI 220
            ...::...|..|:    ...|:.....|......:....:.:....:.:.:.|.|:....:.||.
 Worm   168 IVDEIVNLHIFSL----TTEEWRSVLPDSAMRDTVDLFEAMVKTIAENMAKSPGLEIISKYIEKT 228

  Fly   221 ---EVHFIDRLRDIMKEYQTNPQPGYYVLCHGDYHTRNIMVKHNKESGGFEDCMLLDYQ-GCYVA 281
               :..|:.:..|   ||....:..  ||.|||..:..|:...:....|     ::|:| |...:
 Worm   229 FDKDPSFMTKFSD---EYLEGKRKS--VLTHGDLWSPQILWDKDDNIAG-----IIDWQVGHQGS 283

  Fly   282 PLAFDLMYSIYMLMNREQRIGELETLLNYYFSVLRETLRKIGYQGKLPDPPAFWKEMYRLKDYEF 346
            |:. ||...:....:.|.|....:.||::||..|...|.:.|.  |:|     |......::|..
 Worm   284 PME-DLHRILSTGTSVENRNKLTKPLLDHYFEKLSAGLEEKGV--KMP-----WTREEVDEEYNH 340

  Fly   347 LFLSTYLPMSVGLSLETATNE--------ETDDK------------LQDFIEECKSIL 384
            .|       |.|.|:...:|.        :||.|            .|.::||...:|
 Worm   341 CF-------SYGASITIFSNGIWSSSPILQTDGKPDPARISESFARCQSYVEEAVQVL 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 58/325 (18%)
APH <202..320 CDD:279908 28/121 (23%)
C29F7.1NP_001379235.1 CHK 142..322 CDD:214734 40/200 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.