DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and T16G1.5

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_506235.1 Gene:T16G1.5 / 179775 WormBaseID:WBGene00011799 Length:434 Species:Caenorhabditis elegans


Alignment Length:437 Identity:78/437 - (17%)
Similarity:135/437 - (30%) Gaps:126/437 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VLRSHEKEPDLRV---------------TKLDFTPGSAKGDNYASVIIRARVEYITQKGFFSKSL 73
            :..:|.|..|:::               |||...   ..|:.:.|.::....::........:.:
 Worm    15 LFETHVKLEDIQILIKEQMNTDSKLGEKTKLTVV---GDGNGFMSRVVLVEADWTIPNENLPEKI 76

  Fly    74 IIK----------------------------TVLEMFAGSA--LFKTEIGMYRKVLPEFARILRE 108
            |:|                            .:..||...|  :...|:.:|        ||..:
 Worm    77 ILKLTSCINVHHLVSQMKEKNPDAFTEQQEAELWAMFEREAQNVHNREVNLY--------RITEK 133

  Fly   109 NNDTSRLYAECIYYSLEPSQVMIFEDLGEMDYAMVRDRVLTH-------GEICGAYSKLAKFHAL 166
            .|....|.:..||:..:.......:.:..|:|  |.|.|:.|       .|:......||...|.
 Worm   134 WNKNDALLSPKIYFYKKFDCENKTQGVLGMEY--VDDAVVRHLYCNAKPHELHPILQSLATLQAG 196

  Fly   167 SMKIINERPEFVKEFKDGICLVDIPYMSSGMGPFKDFLGRIPELDRYKTHFEKIEVHFIDRLRDI 231
            |:.:..:....:..:                 .||..:||:...:..|..:        .|.|.|
 Worm   197 SLHLTEDEINSISGY-----------------DFKSMVGRMMSEEGMKQMY--------TRARQI 236

  Fly   232 MKEYQTNPQPGY------------------------YVLCHGDYHTRNIMVKHNKESGGFEDCML 272
            ..|..|.|....                        .||.|||....||:.|.|  .|......:
 Worm   237 NPERLTKPTDAVEALGMDIVNFEISCHVNKYAGIQKNVLVHGDLWAANILWKEN--DGNCVASKV 299

  Fly   273 LDYQGCYVAPLAFDLMYSIYMLMNREQRIGELETLLNYYFSVLRETLRKIGYQGKLPDPPAFWKE 337
            :|||..::...|.||:......::...|....|.||..::....|.|.    ..:.|......||
 Worm   300 IDYQLIHMGNPAEDLVRVFLSTLSGADRQAHWEKLLEQFYEYFLEALE----GNEAPYTLDQLKE 360

  Fly   338 MYRLKDYEFLFLSTYLPMSVGLSLETATNEETDDKLQDFIEECKSIL 384
            .|||   .|:....::....|...:...:..||:   :.:||.:.:|
 Worm   361 SYRL---YFVGGGLFVMPLFGPVAQAKLSYSTDN---ENVEEYREVL 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 59/337 (18%)
APH <202..320 CDD:279908 30/141 (21%)
T16G1.5NP_506235.1 DUF1679 8..420 CDD:369592 78/437 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.