DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and F58B4.5

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_505788.1 Gene:F58B4.5 / 179513 WormBaseID:WBGene00010238 Length:423 Species:Caenorhabditis elegans


Alignment Length:435 Identity:94/435 - (21%)
Similarity:161/435 - (37%) Gaps:123/435 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PEW--------LNEQFVTDVLRSHEKEPDLRVTKL-DFTPGSAKGDNYASVIIRARVEYITQKGF 68
            |:|        |.|:||..:   ..:.|.:.:||| ||:.|....|:       |::     ||.
 Worm    58 PKWVGASENEELPEKFVVKI---SSQLPFIEMTKLMDFSSGDEFWDD-------AKL-----KGM 107

  Fly    69 FSKSLIIKTVLEMFAGSALFKTEIGMYRKVLPE------FARILREN--NDTSRLYAECI--YYS 123
            ...:.:            |...|:..|:.::.|      |.::....  :|.::|.|..|  || 
 Worm   108 GEVTRL------------LHNREVATYKILMREKHPKIPFTKVYASKPFDDENKLKAYLISEYY- 159

  Fly   124 LEPSQVMIFEDLGEMDYAMVRDRV-LTHGEICGAYSKLAKFHALSMKIINERPEFVKEFKDGICL 187
              |:    ...:|..:.....|.: :.|.        :|.|.|:.||:..|..::.:    |...
 Worm   160 --PN----IHHIGMHESIPAEDLIPVIHA--------IAAFSAIGMKLSEEETKYAR----GADF 206

  Fly   188 VDIPYMSSGMGPFKD--FLGRIPELDRYKTHFEKIEVHFIDRLRDIMKEYQTNPQP--------- 241
            :||.:     |.|.|  .:.|:..|  .|..|.:..:..::.:..|.|:|...||.         
 Worm   207 LDIVF-----GQFMDEKSIERMNVL--LKASFPEEYLEKVEEMLKIYKDYYFQPQMIKNFKNTCQ 264

  Fly   242 --GYY-VLCHGDYHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRIGE 303
              ||. ||.|.|..:.|.:...:.|....:  .::|:|...:...|.|:.......::.:.|..:
 Worm   265 FFGYKPVLTHSDLWSSNFLCTRDGEKVTLK--AIIDFQTVSITTPAQDVGRLFASCLSTKDRREK 327

  Fly   304 LETLLNYYFSVLRETLRKIGYQGKLPDPPAFWKEMYRLKD-YEFLF-------LSTYLPMSVGLS 360
            .:.||..|::.....|..:       |.|..:::   ||| |:..|       |....||   |.
 Worm   328 ADFLLEEYYNTFVNELDGM-------DVPYTFQQ---LKDSYQVYFPLMTTMVLPGIAPM---LQ 379

  Fly   361 LETATNEETD-------DK----LQDFIEECKSILARFERSGYFE 394
            ....|.|..|       ||    |:|.|...:|.:..|.:  |||
 Worm   380 HSNVTEEYKDSMKQVALDKMIGLLEDVITTHESNIKNFPK--YFE 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 57/301 (19%)
APH <202..320 CDD:279908 26/131 (20%)
F58B4.5NP_505788.1 DUF1679 3..414 CDD:369592 90/423 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.