DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and F59B1.8

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_504022.2 Gene:F59B1.8 / 178784 WormBaseID:WBGene00019100 Length:420 Species:Caenorhabditis elegans


Alignment Length:428 Identity:87/428 - (20%)
Similarity:151/428 - (35%) Gaps:104/428 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NVPEWLNEQFVTDVLRSHEKEPDLRVTKLDFTPGSAKGDNYASVIIRARVEYITQKGFFSKSLII 75
            :|.:.:.||..|:...:.|.:.::          ..:|:.::|.:|.....:........|.||:
 Worm    24 DVNKAIKEQMSTESELTAESKMEV----------IGEGNGFSSCVILITCHWTIPSSHLPKKLIL 78

  Fly    76 KTVLEMFAGSALFKTEIGMYRKVLPE--------FARILRENNDTSRLYAEC-----------IY 121
            |.|..:.....|.|:.......:.||        |.:..::.::....:.|.           ::
 Worm    79 KIVSFVHVQGLLNKSNEEGNSVMSPEEEAHVHAHFEKSCQKGHNLEVEFCEAFGHLEGLLLPKVF 143

  Fly   122 YSLEPSQVMIFED----LGEMDYAMVRDRVLTH-------GEICGAYSKLAKFHALSMKIINERP 175
            :|.:      ||:    .|.:....|...|:.|       .|:......||:..|||:.     .
 Worm   144 FSQK------FEEDNPNKGFVGMEFVEGSVVRHCYENVTVDELQPILKALARLQALSLS-----T 197

  Fly   176 EFVKEFKDGIC----LVDIPYMSSGMGPFKDFLGRIPELDRYKTHFEKIEVHFIDRLRDIMKE-- 234
            |..:...:|..    |:|   |.|..| .|....:...:|:..:  ||:|     |:....||  
 Worm   198 ESCRNLDNGEAFEESLMD---MLSEDG-LKGIFDQSRNIDQKLS--EKVE-----RIEQNHKEIL 251

  Fly   235 -----YQTNPQPG--YYVLCHGDYHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMYSIY 292
                 ...|...|  ..|:||||....||:  ..:..|||....:||||..::...|.||:..:.
 Worm   252 NLETVLNLNKVVGIDQKVICHGDLWAANIL--WTQTDGGFIADKVLDYQESHMGNPAEDLVRLLV 314

  Fly   293 MLMNREQRIGELETLLNYYFSVLRETLRKIGYQGKLPDPPAFWKEMYRLKDYEFLFLSTYLPMSV 357
            ..::...|....|.:|..:::...:   :|| ....|         |.|:..:..| ..|.|:. 
 Worm   315 STISGADRQSHWEHILEQFYTYFTD---EIG-SNNAP---------YTLEQLKTSF-KLYFPVG- 364

  Fly   358 GLSLETATNEETDDKLQDFIEECKSILARFERSGYFEN 395
            .|:|.:......|.|||..            .||..||
 Worm   365 ALTLISLFGPAVDMKLQGM------------ESGKAEN 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 65/319 (20%)
APH <202..320 CDD:279908 29/126 (23%)
F59B1.8NP_504022.2 DUF1679 8..414 CDD:369592 87/428 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.