DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and D1044.1

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001367707.1 Gene:D1044.1 / 175763 WormBaseID:WBGene00017027 Length:376 Species:Caenorhabditis elegans


Alignment Length:344 Identity:77/344 - (22%)
Similarity:131/344 - (38%) Gaps:87/344 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 VLPEFARILRENNDTSRLYAEC----------IYYSLEPSQVMIFEDLGEMDYAMVRDRVLTHGE 152
            |.|.|.:|.|    .|.:.|.|          |..:|...:|..:.|...:.::........:||
 Worm    60 VSPIFVKIPR----ISAINAACDPDNADENMEILRTLTAQEVTFYSDFSGIQFSGFPIPRSYYGE 120

  Fly   153 ----------ICGAYS----------------------KLAKFHALSMKIINERPEFVKEFKDGI 185
                      .|..||                      .||.|||..::|.:|.|  .|.:::  
 Worm   121 NLGNEKMAGLACEDYSGKVYSIDFVPGFDESQVLQLLEALAHFHAKIIEISDEIP--WKNYEN-- 181

  Fly   186 CLVDIPYMSSGMGPFKDF--------LGRIPELDRYKTHFEKIEVHFIDRLRDIMKEYQTNPQPG 242
            .|.|..|:........||        .|||.|:   |..|::      |.:|:..|:.:....| 
 Worm   182 VLYDAAYIRMLHNDTLDFEKLCPAELSGRIQEV---KHAFDE------DGVRNSEKKNEKLGMP- 236

  Fly   243 YYVLCHGDYHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRIGELETL 307
             .|:||.|.:..|::  .|.|:|..:  ..:|:|.....|::||::..:.:.::.|.|....:..
 Worm   237 -LVICHNDLNASNVL--WNNETGKIQ--AFIDFQHVSKGPVSFDIIRILCLGLSVENRRANTQRY 296

  Fly   308 LNYYFSVLRETLRKIGYQGKLPDPPAFWKEMYRLKDYEF-----LF-LSTYLPMSVGLSLETATN 366
            ||:|::..:      .:....|...:..:|.|| ..:.|     || ||.|..|....||:..:.
 Worm   297 LNHYYTTFK------SHFSTAPFTFSQLEESYR-THFNFVNATSLFSLSYYYKMYKDESLDLKSG 354

  Fly   367 -EETDDKLQDFIEECKSIL 384
             :|.:.|.|:.:.....||
 Worm   355 ADEREHKAQEILRRTIGIL 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 59/275 (21%)
APH <202..320 CDD:279908 30/125 (24%)
D1044.1NP_001367707.1 CHK 130..308 CDD:214734 45/202 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I7662
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I4083
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.