DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and AgaP_AGAP008987

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_319737.4 Gene:AgaP_AGAP008987 / 1279949 VectorBaseID:AGAP008987 Length:418 Species:Anopheles gambiae


Alignment Length:404 Identity:90/404 - (22%)
Similarity:160/404 - (39%) Gaps:77/404 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SAKGDNYASVII----------RARVEYITQKGFFSKSLIIK------TVLEMFAGSALFKTEIG 93
            :|.||||.|.::          :..:|.:        .|:.|      ..||:|.....|..|..
Mosquito    35 TAPGDNYGSTMLAVTDNSSNDDQPPIELL--------HLVAKMRPSSEEFLEIFQIDITFVKEAA 91

  Fly    94 MYRKVLPEFARILRE-----NNDTSRLYAECI--YYSLEPS-------QVMIFEDLGEMDYAMVR 144
            :|.|::|....:.||     :.:...::..|.  ..||:|:       .||:||:|....|....
Mosquito    92 VYLKIVPSLLALQREQGFDGDGELIDVFCRCFNARVSLDPAVEKVDQDGVMLFENLKLAGYVTAD 156

  Fly   145 DRVLTHGEICG-AYSKLAKFHALSMKIINERPEFVKEFKDGI--CLVDIPYMSSG---------M 197
            .|...:.|:.. ...|||.|||:.:.:...:|:.   |:.||  .||.|. :.:|         |
Mosquito   157 RRKGFNRELARYVLKKLALFHAIPIALRYLKPDV---FETGIHKYLVKID-IDAGLSQATLRQMM 217

  Fly   198 GPFK-DFLGRIPELDRYKTHFEKI-EVHFIDRLRDIMKEYQTNPQPGYYVLCHGDYHTRNIMVKH 260
            ..|: |.|....|.......:.|| |.|  .|...::.:..|    .|..:.|.|....|:|:|:
Mosquito   218 DVFRQDILRTGVEAGLAGRAYAKINECH--RRQAQLISDQLT----CYCTMLHNDLWVNNMMIKY 276

  Fly   261 NKESGGFEDCML--LDYQGCYVAPLAFDLMYSIYMLMNREQRIGELETLLNYYFSVLRETLRKIG 323
              :..|...|.|  :|:|...:..|..|:::.|...:|..:...:|:....|||..|...|.::.
Mosquito   277 --DPTGQVPCSLKFVDFQLIQMDSLVRDVIFFIITSVNDPELEAQLDGYFEYYFQQLAANLARLQ 339

  Fly   324 Y--QGKLPDPPAFWKEMYRLKDYEFLFLSTYLPMSVGLSLETATNEETDDKL--------QDFIE 378
            :  |.:| ...:|.:|:.|:..:|...:.:.|.:.:..........|.|..|        :|:..
Mosquito   340 FPSQDEL-TLESFREEIDRVAPFELYHIVSMLRVVLARKESIPDQSEQDAALFFNDNLVEEDYYR 403

  Fly   379 ECKSILARFERSGY 392
            ..:..|..:::.|:
Mosquito   404 RLEVTLRIYDQRGW 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 76/322 (24%)
APH <202..320 CDD:279908 29/120 (24%)
AgaP_AGAP008987XP_319737.4 EcKinase 37..340 CDD:281023 76/322 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.