DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and AgaP_AGAP008704

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_314809.3 Gene:AgaP_AGAP008704 / 1275553 VectorBaseID:AGAP008704 Length:358 Species:Anopheles gambiae


Alignment Length:359 Identity:85/359 - (23%)
Similarity:147/359 - (40%) Gaps:74/359 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SLADQLNVPEWLNEQFVTDVLRSHEKE----PDLRVTKLDFTPGS-AKGDNYASVIIRARV---- 60
            ::||:...|  :...:|.:.:|....|    |||  ..:||...: .:.|.|.|.:.:|.:    
Mosquito     9 AMADRKITP--MFNDYVYEAIRRIAVEQGFTPDL--FSVDFDEETRLECDGYVSFVFKAIINGDD 69

  Fly    61 -EY-----ITQKGFFSKSLIIKTVLEMFAGSALFKTEIGMYRKVLPEFAR------ILRENND-- 111
             |:     :...| ..:||            .|||.|...||:.|..|..      :..|:.|  
Mosquito    70 REFTLWCKVPPNG-DERSL------------ELFKRECFFYRETLHGFYEFQAEKGLSEESGDGF 121

  Fly   112 --TSRLY-AECIYYSLEPSQVMIF---EDLGEMDYAMVRDRVLTHGEICGAYSKLAKFHALSMKI 170
              |.:.| |.|...:.||..:::.   |...:.|:..:....:.|..:  ...:|.:.||||..:
Mosquito   122 YATPKCYLAHCNTDAPEPEALIMLEYNEAFEKWDWDKLEPINVEHTRL--VMEQLGRLHALSFAM 184

  Fly   171 INERPEFVKEFK----DGICLVDIPYMSSGMGPFKDFLGRIPELDRYKTHFEKIEVHFIDRLRDI 231
            ..:|||..:::|    ....|:.:         .|:...|  .|...:|.||. |...|..::|.
Mosquito   185 KEQRPELFEQYKRAGQPDSALITL---------MKESFDR--ALITMRTRFES-EQERIVAVKDA 237

  Fly   232 MKEY------QTNPQPGYYVLCHGDYHTRNIMVKHNKESGGFEDCMLLDYQGC-YVAPLAFDLMY 289
            :.|.      .|..:| |.|:.|||....|::..|| |:......:|.|:|.. |.:|: .||.|
Mosquito   238 VFESLKTCCDPTTAEP-YCVVTHGDCWINNLIYSHN-ENNVATGVILTDWQSSRYASPI-LDLCY 299

  Fly   290 SIYMLMNREQRIGELETLLNYYFSVLRETLRKIG 323
            ..::....:.|...:::||::|...|.:.|.|:|
Mosquito   300 FFFISAGEQFRRDNMDSLLHHYHGALADFLAKLG 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 74/312 (24%)
APH <202..320 CDD:279908 33/124 (27%)
AgaP_AGAP008704XP_314809.3 EcKinase 53..333 CDD:281023 73/309 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.