DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and AgaP_AGAP003236

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_312943.4 Gene:AgaP_AGAP003236 / 1273909 VectorBaseID:AGAP003236 Length:441 Species:Anopheles gambiae


Alignment Length:452 Identity:99/452 - (21%)
Similarity:165/452 - (36%) Gaps:107/452 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PEWLNEQFVTDVLRSHEKEPDLRVTKLDFTPGSAKGDNYASVIIRARVEYITQKGFFSKS--LII 75
            ||...|..::||..|              ||...  |.:.|.|.:....|.:..|...::  |::
Mosquito    23 PELDGEGKISDVQLS--------------TPDHL--DGFMSTIHKLSFRYESNDGTVVQTLKLMV 71

  Fly    76 KTV------LEMFAGSALFKTEIGMYRKVLPEFARILRENNDTSRLYAECIY--------YSLEP 126
            |.:      .|...|...|..||.:|.||||.|..:|.::...........|        ||.:.
Mosquito    72 KVMKGSDEFRESSMGKTQFTNEIYIYTKVLPAFQELLTDSGLAGDWCPRVYYGEAGHFPTYSDQY 136

  Fly   127 SQVMIFEDLGEMDY-AMVR-DRVLTHGEICGAYSKLAKFHA--LSMKIINERPEFVKEFKDGICL 187
            ..:::.||:..:.| |..| |....|..:...:  :|.|||  .:|::.|:..  :....:||..
Mosquito   137 ETILVLEDISPLGYKAGPRLDLEEEHLRLMARH--IASFHACTYAMRLRNDAR--LASLIEGIAP 197

  Fly   188 VDIPYMSSGMGPFK--DFLGRIPELDRYK---THFEKIEVHFIDR-LRDIMKEYQTNP------- 239
            :|   ..||...|.  |.|.::.....||   .|.|:::.....| :.::.:.|.|.|       
Mosquito   198 LD---FVSGDKTFTSYDVLLKLGANRLYKYLDDHPEQLDSEAFKRDMNNLRQRYGTTPISLMQDL 259

  Fly   240 ---QPGYYVLCHGDYHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRI 301
               ...:.|:.||||:..|::.:.: .:|...:..:.|:|....|....||.:.:||.|..|.|.
Mosquito   260 LRKDETFSVILHGDYNRNNVLFRAD-GAGKPVELKMFDFQENRYATPVIDLTFYMYMSMTEELRN 323

  Fly   302 GELETLLNYYFSVLRE---TLRKIGYQGKLPDPPAFWKEMYRLKD----------YEFLFLSTYL 353
            ...:.::..|.:.|.|   |:.|:..:..|.||       |||:.          |..:....:|
Mosquito   324 RCWDAIVLEYHTALLESLATILKVPQEDGLLDP-------YRLEPFLEHFKRHAMYGVIVTLHFL 381

  Fly   354 PMSVGLSLETATNEETDDKLQDFIEECKS---------------------ILARFERSGYFE 394
            |..:      ...||.:.....|..:..|                     :|......||||
Mosquito   382 PWMM------CPEEECEQLAHHFARDVHSKELAHWTLVCGGEEVDKRLVGVLRHASSKGYFE 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 73/315 (23%)
APH <202..320 CDD:279908 31/134 (23%)
AgaP_AGAP003236XP_312943.4 PKc_like 43..341 CDD:304357 71/305 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.