DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and AgaP_AGAP003220

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_003436421.1 Gene:AgaP_AGAP003220 / 1273895 VectorBaseID:AGAP003220 Length:426 Species:Anopheles gambiae


Alignment Length:398 Identity:86/398 - (21%)
Similarity:163/398 - (40%) Gaps:68/398 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RVTKLDFTPGSAKGDNYASVIIRARVEYITQKGFFSKSLIIKTVLE----------MFAGSALFK 89
            ::.:.:||    |||.|.|.:.|.::.....:....:.|::..|::          .|..:..|:
Mosquito    38 KIPETNFT----KGDAYLSELYRIQLTGEPAEPGRDEPLVVNVVVKTIPKNVGRRNTFRSADFFR 98

  Fly    90 TEIGMYRKVLPEFARI--LRENNDTSRLYAEC-IYYSLEPSQVMIFEDLGEMDYAMV-RDRVLTH 150
            .|...|..||.|..|.  .|:..:..:....| :.|:...:..:..||||:..|... ||:.:..
Mosquito    99 NEANFYNVVLKELYRFQDARKPANPFKDINPCYVAYTDGVNDFVAMEDLGQYGYKTASRDKGVEL 163

  Fly   151 GEICGAYSKLAKFHALSMKIINERPEFVKEFKDGICLVDIPYMSSGMGPFK-DFLGRIPEL---- 210
            .:.......:|:|||||..:..:.||   .|:..:..::..|.|:.:.|:. .|:.||..:    
Mosquito   164 ADCLRCICSMARFHALSFAMKQQEPE---AFERIVSQLEETYYSAALEPWHGPFMQRIVTICKEA 225

  Fly   211 ---------DRYKTHFEKIEVHFIDR-LRDIMKEYQTNPQPGYYVLCHGDYHTRNIMVKHNKESG 265
                     |||..:|.:....|::. :..:|.|. .|.:..|.|:.|||....|.:::.     
Mosquito   226 LDIECTESPDRYTANFRRDAQAFLNSPIYGMMVEL-ANTRNRYAVITHGDCWLPNFLLRP----- 284

  Fly   266 GFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRIGELETLLNYYFSVLRETLRKIGYQGKLPD 330
              :...::|:|....|....||:..:|...::..|....:.||:.|:....|.|.::|     .|
Mosquito   285 --DQVRMIDFQMVRCASPVLDLVLFVYCCTDQALRDTHYDQLLSAYYHAFAELLAELG-----TD 342

  Fly   331 PPAFWKEMYRLKDYEFLFLSTYLPMSVGLSLET---ATNEETD----DKLQ-------DFIEECK 381
            |.|.:.......:     |..:.....|:::|:   |..:|:|    |:|:       |.|...:
Mosquito   343 PQATFPASVLAAE-----LQQFGRFGCGIAVESIPLAQLDESDVPDLDRLEGTEPVPLDQILTVR 402

  Fly   382 SILARFER 389
            ||..::.|
Mosquito   403 SIGTQYGR 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 67/305 (22%)
APH <202..320 CDD:279908 28/131 (21%)
AgaP_AGAP003220XP_003436421.1 EcKinase 46..340 CDD:281023 67/304 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.