DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and AgaP_AGAP003855

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_310414.7 Gene:AgaP_AGAP003855 / 1271592 VectorBaseID:AGAP003855 Length:428 Species:Anopheles gambiae


Alignment Length:379 Identity:93/379 - (24%)
Similarity:163/379 - (43%) Gaps:64/379 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 EWLNEQFVTDVLRSHEKEPDLRVTKLDFTPGSAK-GDNYA-SVIIRARVEYITQKG-------FF 69
            :::|..|:|:::::...|.::::...|..|.||. .|.|| |.:.|..::|.:::.       |.
Mosquito     8 KFVNSLFLTNLIQTQYGETEVKIKAYDVEPASADINDPYARSSMNRILIKYTSKENPTEAVITFV 72

  Fly    70 SKSLIIK----TVLEMFAGSALFKTEIGMYRKVLPEFARILRENNDTSRLYAECIYYSLEPSQVM 130
            :|   ||    .::|.|..:.:|:.||.||:.|||....::.:......|..:.||.|..||.::
Mosquito    73 AK---IKPTEGLLVEQFKKADVFEKEILMYKSVLPSMVTMIAKLGSVIELAPQLIYSSETPSDLV 134

  Fly   131 IFEDLGEMDYAMVRDRV-LTHGEICGAYSKLAKFHALSMKIINER----PEFVK-----EFKDGI 185
            :.|||....|::....: |::.:...|..|||.|||.|..:::|.    |:|.|     |.||.:
Mosquito   135 VLEDLTARGYSVENQTLGLSYEQSKMAVEKLAFFHAASAMMLSENGQAFPKFTKGTFHAEHKDKL 199

  Fly   186 C-LVDIPYMSSGMG-------PFKDFLGRIP------ELDRYKTHFEKIEVHFIDRLRDIMKEYQ 236
            . ..|...|...|.       |..|.|.::|      .::.|::.|:                  
Mosquito   200 SYFPDTIRMVGEMAAELDISQPMADKLLKLPAKALQKAIEAYESDFK------------------ 246

  Fly   237 TNPQPGYYVLCHGDYHTRNIMVKH-NKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQR 300
                 |:.||.|||:.|.||:.|: ..|........::|:|.|.|.....||:|.:......|..
Mosquito   247 -----GFKVLNHGDFWTNNILFKYQGNELVDANFVRVVDFQNCVVGSPIIDLVYFLAASPAHEVL 306

  Fly   301 IGELETLLNYYFSVLRETLRKIGYQGKLPDPPAFWKEMYRLKDYEFLFLSTYLP 354
            ....:.|:..|...|...|:|:||...:|.......|:.:....:.::..|..|
Mosquito   307 EKHRDELVYIYHETLVLLLQKMGYMKSIPSLLELQVELLKHGSLQVIYALTVSP 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 79/314 (25%)
APH <202..320 CDD:279908 27/124 (22%)
AgaP_AGAP003855XP_310414.7 PKc_like 44..330 CDD:304357 79/311 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11012
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.970

Return to query results.
Submit another query.