DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and AgaP_AGAP003763

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_310302.5 Gene:AgaP_AGAP003763 / 1271496 VectorBaseID:AGAP003763 Length:404 Species:Anopheles gambiae


Alignment Length:410 Identity:103/410 - (25%)
Similarity:184/410 - (44%) Gaps:33/410 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DQLNVPEWLNEQFVTDVLRSHEKEPDLR-VTKLDFTPGSAKGDNYASVIIRARVEYITQKGFFSK 71
            |:|:.|||||:.:...||...|.:.:.| :......||:..||::|||:.|..::|      :..
Mosquito     6 DELSSPEWLNDDYFRHVLCKIECDSNARLIGACVLRPGTKAGDHFASVMYRTTLQY------YCT 64

  Fly    72 SLIIKTV--------------LEMFAGSALFKTEIGMYRKVLPEFARILRENNDTSRLYAECIYY 122
            :.:.||:              .::..|...|..||.||.:|||:.|.::| |......|.:.::.
Mosquito    65 ANVKKTINLIMKIKPDTDGFKKDLLDGDDFFGKEIRMYTEVLPQMAALMR-NIGEEYQYPKLVFA 128

  Fly   123 SLEPSQVMIFEDLGEMDYAMVRDRVLTHGEICGAYSKLAKFHALSMKIINERPEFVKEFKDGICL 187
            |..|..::|.||:....:.| ...:.:..|:......:|||||.|:.:..:.|.|..:::..|..
Mosquito   129 SHVPHTIIILEDVSSQGWTM-EGLIKSFSELEPTIDAIAKFHAASVVLQEKDPTFASQYQCTIAK 192

  Fly   188 VDIPYMSSGMGPFKDFLGRIPELDRYKTHFEKIEVHFIDRLRDIMKEYQTNPQPGYYVLCHGDYH 252
            :.........|.|:.|:..:.|....:.....:| ||..::.|:::......:....||.|||:|
Mosquito   193 ILCSMRGMTDGCFRSFISFLSETAELQEFVAPVE-HFHAKIDDVLQAAYAPSETFANVLIHGDFH 256

  Fly   253 TRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRIGELETLLNYYFSVLRE 317
            .:|::  |.:.:|...|.:.:|||.|.......||.|..||:..:..:....:.::..|......
Mosquito   257 FKNLL--HLQLAGKIVDTIFVDYQMCSWCSPVVDLYYLTYMIPEQSVKNAHRDEIIYRYHQKFAS 319

  Fly   318 TLRKIGYQGKLPDPPAFWKEMYRLKD---YEFLFLSTYLPMSVG-LSLETATNEETDD---KLQD 375
            .||::.|:|::|.......|:.|..|   |.::..|.:|...:. :..|......||:   |:::
Mosquito   320 LLRRLNYRGRVPTLTELQVELLRKADLELYHYIVFSAFLHTDLSKVDSEAFFLGRTDNPALKMEE 384

  Fly   376 FIEECKSILARFERSGYFEN 395
            |.|..|..|.||...|..||
Mosquito   385 FKETMKIELKRFLYHGIIEN 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 68/290 (23%)
APH <202..320 CDD:279908 26/117 (22%)
AgaP_AGAP003763XP_310302.5 PKc_like 47..326 CDD:304357 68/289 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D279272at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11012
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.890

Return to query results.
Submit another query.