DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31370 and AgaP_AGAP002136

DIOPT Version :9

Sequence 1:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_308058.4 Gene:AgaP_AGAP002136 / 1269421 VectorBaseID:AGAP002136 Length:437 Species:Anopheles gambiae


Alignment Length:436 Identity:87/436 - (19%)
Similarity:154/436 - (35%) Gaps:125/436 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EQFVTDVLRSHEKEPDLRVT-KLDFT---PGSAKGDNYASVIIRARVEYITQKGFFSKSLIIKTV 78
            |.:|.|||     .|.:... :|.||   |...|     :::....|:.:...||......:.||
Mosquito     8 EAYVRDVL-----IPGMVARGQLAFTEPVPAGVK-----TLLKSVEVKPLVTNGFMLTIPFVVTV 62

  Fly    79 LEMFAGSA---------------------------------LFKTEIGMYRKVLPEFARILRENN 110
            :....|||                                 ||:.|:..|.:::|...:      
Mosquito    63 VLEREGSAQGKEAQEPETLHLIVKITPDCNKEMYESCQFETLFENEMVAYTEIIPALGK------ 121

  Fly   111 DTSRLYAECIYYSLEPSQ-VMIFEDLG-------------EMDYAMVRDRVLTHGEICGAYSKLA 161
              :.||....:...:|:: :|:..|..             .|||.|:            |.::|.
Mosquito   122 --AELYPRYYHCERKPAEALMVMSDFSFSGWKMAPMVVNLPMDYIML------------AVTELG 172

  Fly   162 KFH--ALSMKIINERPEF---VKEFKDGICLVDI------------PYMSSGMGPFKDFLGRIPE 209
            :||  ...:|:.: ||:|   :.:||:.....||            |..:........|.|.:| 
Mosquito   173 RFHGECYGLKVAH-RPQFDSMIAKFKESRYAADITDHTWKAVMTVAPMRAIKALKESRFKGLVP- 235

  Fly   210 LDRYKTHFEKIEVHFIDRLRDIMKEYQTNPQPGYYVLCHGDYHTRNIMVKH--NKESGGFEDCML 272
                ..:.||:...|.|....  .:.:..|:....|:|||||...|:..::  .|........|:
Mosquito   236 ----ADYLEKLARLFQDPWEH--AKGKVKPREPLAVICHGDYLRNNMAFRYADAKNPARPTQVMM 294

  Fly   273 LDYQGC-YVAPLAFDLMYSIYMLMNR--EQRIGELETLLNYYFSVLRETLRK-IGYQGKLPDPP- 332
            .|:|.. |.:|:   :.|:.::..:.  .:|....:|:...|...|.:|:.. :|.......|| 
Mosquito   295 FDFQTLRYASPM---IDYAAFLANSTGYAEREHHFDTIFRTYHGALVQTVATVVGVPEPADLPPY 356

  Fly   333 ----AFWKEMYRLKDYEFLFLSTYL-----PMSVGLSLETATNEET 369
                :|.:|:.....|.|...|.:|     ||.:..:....|.||:
Mosquito   357 FSYESFHRELAEYYSYGFNIASAFLMILHEPMEISFTENIFTEEES 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 63/346 (18%)
APH <202..320 CDD:279908 27/122 (22%)
AgaP_AGAP002136XP_308058.4 PKc_like 79..340 CDD:304357 53/291 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.